[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53909.1


[Show Plain Result]

## Summary of Sequence Search
   1::175
  14::173  PF10969 0.0% 40.6451612903226  Protein of unknown function (DUF2771) 
   1::175


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASRKTKRKNLIQILSLIVAVLLVVILSVVFQQWWNNRPEPLPQEISISASSPAGEIEVFPFSMCEPGVE
PF10969         -------------ivalllavvvvllaavagvgvwllvresepeepeisayshgravrvgPyqyCdvlle


                         -         -         *         -         -         -         -:140
query           CEENEVPTLEVGADEELHLTIPEAIHDHDWYLLTIYDDPAANDEFYHTSYDATEATVPGSVDPTEEGAER
PF10969         deCeepeaqgeLevpereplqLsvPeaiadapWrllrvYedpadttvtefrpkerlavTipssvdp....


                         +         -         -         -         -         *         -:210
query           PRLVVVEVSAVMIGEDENGEESPYTVTWSLSTMNE-----------------------------------
PF10969         .ergrLvgvevqlltlvldeeGeetevphaeWs-------------------------------------