[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53991.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
   6::135  PF00578 0.0% 25  AhpC/TSA family 
  24::141  PF08534 0.0% 25 PF08534 Redoxin 
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
PF00578         -----kapdfelkdtd...gkkvslsdlkgkpvvLffypkdfcpvCt.telpalaelyeefkkkgvevig
PF08534         -----------------------slsdfkgkkvvlvfvpgafcptCsaehp.yleklaklakekgvdvva


                         -         -         *         -         -         -         -:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQ
PF00578         vsv..dspe.....shkkfaeknelnfpllsD...eegevakaygvlneekglalratfvidkeg-----
PF08534         vvaqndaf.......vkeawakeglkipvlsD......esasfakalglrltedasagirtpryavided


                         +         -         -         -         -         *         -:210
query           VDDFVLGLLLGSLLSETDET--------------------------------------------------
PF00578         ----------------------------------------------------------------------
PF08534         g---------------------------------------------------------------------