[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54034.1


[Show Plain Result]

## Summary of Sequence Search
   1::164
 128::164  PF05901 0.0% 43.2432432432432  Excalibur calcium-binding domain 
   1::164


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSFPNLKYSIKGSTDSSGRMKRLALIGSSLIISMGLITACGSANAEPETPTPTVTETVTSTKTTTVKAST
PF05901         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ITTTVTETAPAEDLGQEAVEPAAVEEYSEPQVNVPQQFAAIPDPAPAVAPAPAPAPAYYANCAAARAAGA
PF05901         ---------------------------------------------------------afknCtemrkkyk


                         +         -         -         -         -         *         -:210
query           APIYAGSPGYSSKLDRDGDGIACE----------------------------------------------
PF05901         agvykkdtkykaylDrDkDGiACE----------------------------------------------