[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54079.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
   3::140  PF03358 0.0% 40.1515151515151  NADPH-dependent FMN reductase 
   3::93   PF02525 0.0% 24.1379310344828  Flavodoxin-like fold 
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
PF03358         --kilvisGslrkgsntrklaewaaealaea.gaevelidladlilplcdedlee.....esddlqelle
PF02525         --kiLiinahprpeksfssalaqafvealeeagphevtvrdLyadflpvlttrdlalayeek..p.adve


                         -         -         *         -         -         -         -:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELQIAHVQK
PF03358         kiaaadgviivtPeYngsypgllKnalDrlskkelrgKpvalvavgggragglraeealrpvlaelgavv
PF02525         seq.iekllaadvivlqfPlwwf-----------------------------------------------


                         +         -         -         -         -         *         -:210
query           TGLLSIFTDFEYPNFKPSEQGISSVDAMLEQLVVWTKAMSTIRESANV----------------------
PF03358         ----------------------------------------------------------------------
PF02525         ----------------------------------------------------------------------