[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54082.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
  19::328  PF07690 0.0% 28.4313725490196  Major Facilitator Superfamily 
 237::395  PF07690 0.0% 20.3821656050955  Major Facilitator Superfamily 
  47::195  PF00083 0.0% 28.3783783783784  Sugar (and other) transporter 
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSEYNASASKSTKLILTALALGVFGVGVTEFVPVGLLPQIANTFDTSIATTGWVISSYAAGVMVGAPIMT
PF07690         ------------------lllaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiaslla
PF07690         ------------------lllaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiaslla
PF00083         ----------------------------------------------ssvlsglivssflvgaliGslfag


                         -         -         *         -         -         -         -:140
query           LLSIRRPRKQMLIILMVLFIIGNLLSAVAPNFALLIIGRIVTSFTHGAFFGIGTVVAAELAGPGQRGAAV
PF07690         GrlsdrfGrrrvlllglllfalglllll.fasslwalllvlrvlqGlgagalfpagaaliadwfpkeerg
PF07690         GrlsdrfGrrrvlllglllfalglllll.fasslwalllvlrvlqGlgagalfpagaaliadwfpkeerg
PF00083         lladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrg


                         +         -         -         -         -         *         -:210
query           AYMFSGISLANLIGVPIGTWIGTMANWRTTFLVIAALGILTAVAIAYLVPNLPSPKNVRVGREIKALTHP
PF07690         ralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrk
PF07690         ralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrk
PF00083         algslyqlaitvGilvaaiiglglnktsn.adgwrillglqlvpallllllllfl---------------


                         -         -         -         +         -         -         -:280
query           QVILALLMTLFGFGGVFAALTYLTPIMTDIAGYAESSMSWILIIVGVGMFTGNWTGGKLADRSLIPSVLA
PF07690         epaplvpawklllkppvlw.llialllaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvll
PF07690         epaplvpawklllkppvlw.llialllaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvll
PF00083         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MLFLLAATLFAFNFTAHSAILSLITIFFIGFFGMATVAPLQSVVLEYAKGAPTLASSINIGVFNLGNAVA
PF07690         lglllfalglllll.fasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGa
PF07690         lglllfalglllll.fasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGa
PF00083         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AWLAGATITTSLGLTSAGLVGGLMTSLGLVLAIVAVVLRRKAQETRTTISVVEQQPAA------------
PF07690         ilgpllgglla.sslgWravFlilailsllaavlvllllpreppe-------------------------
PF07690         ilgpllgglla.sslgWravFlilailsllaavlvllllpreppe-------------------------
PF00083         ----------------------------------------------------------------------