[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54084.1


[Show Plain Result]

## Summary of Sequence Search
   1::81
  24::75   PF02609 0.0% 44.2307692307692  Exonuclease VII small subunit 
   1::81


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTNPDIVGSGQGNDSFEPVAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGAS
PF02609         -----------------------FEealaeLeeivekLEsgelsLeeslklyeeGvkLlkeCqkkLeeae


                         -         -         *         -         -         -         -:140
query           ARVEQALNQAE-----------------------------------------------------------
PF02609         qkiek-----------------------------------------------------------------