[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54269.1


[Show Plain Result]

## Summary of Sequence Search
   1::325
   2::318  PF00231 0.0% 47.4048442906574  ATP synthase 
   1::325


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
PF00231         -aslkeikrriksvkntqkItkAMkmvaaaklrkaqerveaarpYaeklekvlselaskseelehplleq


                         -         -         *         -         -         -         -:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVLKKAAELEKLLAESGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
PF00231         reevkkvllivitsDrGLcGgfNsnvikaaeellkelkaegkevkllvvGkkgrdflkrrkkevvaevtg


                         +         -         -         -         -         *         -:210
query           SQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISMLTQNPVVHQLLP
PF00231         vsdkptfeeaqeiaeelielfekge....................vdevelvynkfvnalsqeptveqll


                         -         -         -         +         -         -         -:280
query           VEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRRLFSIFLEAAAAESASRRNAMKS
PF00231         pi........ekeakeeeeeeeesesdyefepdaeevleellpkyvesqiyrallesaasEhaaRmtAMk


                         -         *         -         -         -         -         +:350
query           ATDNASELVKDLSRVANQARQAQITQEITEIVGGAGALADSGESD-------------------------
PF00231         sAtdNakelikkLtlqynraRQaaITqEliEIvsGaea--------------------------------