[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54313.1


[Show Plain Result]

## Summary of Sequence Search
   1::123
   1::123  PF05025 0.0% 47.9674796747967  RbsD / FucU transport protein family 
   1::123


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPEVVVEGAVIA
PF05025         mkktplLnpellkvlaamGHgdeiviaDaglPiesapeevkridlalrlggpsflevleavlselpveka


                         -         -         *         -         -         -         -:140
query           EGTPERIREMVDTDVEVVTHEELKAQLAECAFVIRTGETTAYANVIFKSGVAF-----------------
PF05025         vlaeeikeenpelleelekeleelkaeegseveieavereafkerakkakavi-----------------