[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54333.1


[Show Plain Result]

## Summary of Sequence Search
   1::165
  20::58   PF07673 0.0% 56.4102564102564  Protein of unknown function (DUF1602) 
   1::165


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSSWSWSSRRVRASRAPKGSSRSIIGGSMAKARAMPTRCCMPPERRAGRRSAASVRPTCSRWVRVMSAR
PF07673         -------------------GSSasrisGsiasaRAiATRCcsPPdsspGyllalssrP------------


                         -         -         *         -         -         -         -:140
query           SVLLKEGRAERRPKSMLPRAVNQGRRAWSWKTMPRSGPGPLISSLPALTVPVDGEASPAIILRIVDFPQP
PF07673         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGPRRETNSPSLMVMLVSPMIVVEP---------------------------------------------
PF07673         ----------------------------------------------------------------------