[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54336.1


[Show Plain Result]

## Summary of Sequence Search
   1::391
  56::176  PF09084 0.0% 22.6086956521739  NMT1/THI5 like 
   1::391


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTHTLFDSRRFLQLGAFASLSTALAGAARYVTSTSNNEPADNTPLTIGYVPIACSAPIAIANALGLFKKH
PF09084         -------------------------------------------------------aglyvAqekGyFkee


                         -         -         *         -         -         -         -:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
PF09084         GLdVeilepadpsdavelvaagkadfgvsyqeslllara....kglpvvavaallqeplnglivlkdsg.


                         +         -         -         -         -         *         -:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
PF09084         ikspkDLkGkrigysg.sefekallkallkkaGidp----------------------------------


                         -         -         -         +         -         -         -:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQE
PF09084         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KYLNQPAALLDGPFSGMYQDWHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGLGGDVLTMDDSTIINA
PF09084         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AQSVLTPGLSVTGEHLNIISADFAPVTPTSGYEHMDSVIFR-----------------------------
PF09084         ----------------------------------------------------------------------