[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54367.1


[Show Plain Result]

## Summary of Sequence Search
   1::185
   1::179  PF00343 0.0% 50.8670520231214  Carbohydrate phosphorylase 
   1::185


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYQ
PF00343         iPaadlseqistagteasGtsnmkfalnGaltiGtldGanveiaeevGeenlfifGarveeveklrkkgy


                         -         -         *         -         -         -         -:140
query           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
PF00343         kekeyyekdkrleevleqiesgafspedkdefkdllds.....llqagdeylvladfesyvdaqekvdel


                         +         -         -         -         -         *         -:210
query           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPTPAVKK-------------------------
PF00343         yk.drekWtkksilniaasgkfssdrtikeyakeiWeie-------------------------------