[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54487.1


[Show Plain Result]

## Summary of Sequence Search
   1::268
   7::92   PF02535 0.0% 25.9259259259259  ZIP Zinc transporter 
 123::262  PF02535 0.0% 28.9855072463768  ZIP Zinc transporter 
   1::268


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDTSTVLFAFGLTLFAGLATGIGGLIAVSRKTVTEGFLAGSLGFSVGVMLYVSFVEILPGAFDELTSVWG
PF02535         ------nllfalttplGaliGiav.saadnsgrsdlvtgillalaaGtflYvalvellpeelaneks...
PF02535         ------nllfalttplGaliGiav.saadnsgrsdlvtgillalaaGtflYvalvellpeelaneks...


                         -         -         *         -         -         -         -:140
query           EKGGSWAAVIGFFGGIALIAIIDRLVPTAINPHEPSTVGGAVEGFERRNRMMKMGVLTALAIAIHNFPEG
PF02535         .lkqnllqllglllGfalmlll------------------------------viaillvlglglHsfieG
PF02535         .lkqnllqllglllGfalmlll------------------------------viaillvlglglHsfieG


                         +         -         -         -         -         *         -:210
query           FATFLAGLSDPTIAIPVAVAIAIHNIPEGIAVAVPLREATGSRRKALGWATLSGLAEPAGALIGFLLLMP
PF02535         LAiGvsssedt..gislflAvllHelphelglgaiLlkagasrkkavllnllfalttplGaliGiavsaa
PF02535         LAiGvsssedt..gislflAvllHelphelglgaiLlkagasrkkavllnllfalttplGaliGiavsaa


                         -         -         -         +         -         -         -:280
query           FIGPEALGLCFAAVAGVMVFISVDELLPTAISSGKHHTAIYGLIAGMAVMAISLLLFI------------
PF02535         dnsgrsdlvtgillalaaGtflYvalvellpeelanekslkqnllqllglll------------------
PF02535         dnsgrsdlvtgillalaaGtflYvalvellpeelanekslkqnllqllglll------------------