[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54563.1


[Show Plain Result]

## Summary of Sequence Search
   1::140
   6::134  PF01451 0.0% 29.4573643410853  Low molecular weight phosphotyrosine protein phosph 
   1::140


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDQPSVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGID
PF01451         -----kvlFvClgNicRSpmAeallrallekkvevesaGsethegesvdpravevlkehgidlsghrarq


                         -         -         *         -         -         -         -:140
query           LDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRLVRDDIDARVQNLIAELTQNA
PF01451         iteeelkefDliltmdgealrellevapearakvkllgdpakqkdiddpyygdedgfeevrdei------