[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54635.1


[Show Plain Result]

## Summary of Sequence Search
   1::422
  14::208  PF00926 0.0% 63.2124352331606  3,4-dihydroxy-2-butanone 4-phosphate synthase 
   4::35   PF00925 0.0% 36.6666666666667  GTP cyclohydrolase II 
 215::386  PF00925 0.0% 63.3136094674556  GTP cyclohydrolase II 
   1::422


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSEHEQAHSQLDSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELATPELVAFMVRYSSGYICAPLTA
PF00926         -------------ieeaiealkaGklvivvDdedrEnegdlvvaAeavtpekvafmvrharGlicvalte
PF00925         ---rcdcgeqLdealeriaee..grGvivylrqeg-----------------------------------
PF00925         ---rcdcgeqLdealeriaee..grGvivylrqeg-----------------------------------


                         -         -         *         -         -         -         -:140
query           KDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAR
PF00926         eraeklgLppmvdkntsekktaftvsvdhakgtttGIsaadRalTirkladekakaedfvrPGhvfplra
PF00925         ----------------------------------------------------------------------
PF00925         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRK
PF00926         keggvlerrGhTEaavdLarlagltpaaviceildd.dg.smarleelkefakehglklitiedliey--
PF00925         ----------------------------------------------------------------------
PF00925         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NEILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCD
PF00926         ----------------------------------------------------------------------
PF00925         ----vervaeaelptefgefrlvafrdkvdgkehlalvkgdi.s.edepvlVRvHsecltgDvlgslrcd
PF00925         ----vervaeaelptefgefrlvafrdkvdgkehlalvkgdi.s.edepvlVRvHsecltgDvlgslrcd


                         -         *         -         -         -         -         +:350
query           CGQQLHESLRLIQEAGRGVVVYMRGHEGRGIGLLAKLRAYQLQDEGADTVDANLALGLPADAREFGTSAQ
PF00926         ----------------------------------------------------------------------
PF00925         cgeqLdealeriaeegrGvivyl.rqegrgiglleklraynlqdegldtveanlalglpadeRdygigaq
PF00925         cgeqLdealeriaeegrGvivyl.rqegrgiglleklraynlqdegldtveanlalglpadeRdygigaq


                         -         -         -         -         *         -         -:420
query           ILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIPVAVHEDNVRYLKTKRDRMGHDLPDVALWEQEHP
PF00926         ----------------------------------------------------------------------
PF00925         ILrdlGvrkirLltnnpekieaLegfglevvervpl----------------------------------
PF00925         ILrdlGvrkirLltnnpekieaLegfglevvervpl----------------------------------


                         -         -         +         -         -         -         -:490
query           EN--------------------------------------------------------------------
PF00926         ----------------------------------------------------------------------
PF00925         ----------------------------------------------------------------------
PF00925         ----------------------------------------------------------------------