[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54728.1


[Show Plain Result]

## Summary of Sequence Search
   1::149
  15::146  PF00692 0.0% 46.875 PF00692 dUTPase 
   1::149


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
PF00692         --------------eaeiierkrsedAgyDLsaakdftlkpgetvlvptdlsislpkgtaglilgrssla


                         -         -         *         -         -         -         -:140
query           AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKVELVDFEEVEELDDTVRGDQ
PF00692         akglivlp...giidsdyrGeikvvlfnlgkk.dvtikkgdriaQLillpvvhaelepveelertergss


                         +         -         -         -         -         *         -:210
query           GYGSTGKTA-------------------------------------------------------------
PF00692         gfgssg----------------------------------------------------------------