[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54831.1


[Show Plain Result]

## Summary of Sequence Search
   1::622
 329::596  PF00905 0.0% 30.3370786516854  Penicillin binding protein transpeptidase domain 
  32::140  PF05223 0.0% 32.1100917431193  NTF2-like N-terminal transpeptidase domain 
   1::622


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKVQRRSLMALCMTVAFAGGSLTACTPRPDTADPIAEEFLQAWASQDFDTIADITDQADLATEMLSTSF
PF00905         ----------------------------------------------------------------------
PF05223         -------------------------------saeeaaetFldawakgdykkaasltseasKkeisekeav


                         -         -         *         -         -         -         -:140
query           DGLQADSVELTLDSVDSRDTIATANFSVVWKLPRDREVSYDSSMTLTKMRNEWTVRWEPSLVHPKLGANQ
PF00905         ----------------------------------------------------------------------
PF05223         eryeaiydglqvkklkieakkvkkdkentaeipykvkmktsagkiktydskltvvkeeeewkidWkpsli


                         +         -         -         -         -         *         -:210
query           HLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDADVVVKRVADYLNEAHATDENVNTLDVEDIM
PF00905         ----------------------------------------------------------------------
PF05223         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SNLGDSTYSLTTVDANLGARMEQDLAGIPGLTFNEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRA
PF00905         ----------------------------------------------------------------------
PF05223         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SIVTSNGAVIDDIAYDAPELAPSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEAD
PF00905         ------------------------------------------------avvvldpktgevlamaskpsyd
PF05223         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
PF00905         pnrkdknepllnravqgtyePGStfKvvtaaaalengilkpeetfddssglkvggktikdwnktgegtit
PF05223         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
PF00905         lrealekSsntyfvqlaqklgkdklrkylkkfglGnktgidlpgesagkvpkreekgdsattaigqgslt
PF05223         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
PF00905         vtplqmaqayaaiangGklvkPhlvkaivdpdgktaeikpkklgklpisketaekvkealkgvvskgag.
PF05223         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           NEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAVTDQFFVKLDELRAGGEVAVSEAEEQPVG--------
PF00905         aaavagykvagKTGTAevagkkgekdnktyngwfvg----------------------------------
PF05223         ----------------------------------------------------------------------