[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF54857.1


[Show Plain Result]

## Summary of Sequence Search
   1::314
  58::288  PF01497 0.0% 23.4234234234234  Periplasmic binding protein 
   1::314


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQMKISRRAFLGTLLGATTLAVAACAQSSQNQNSSASSSSSSSAESSTSPSSSDEQRIVALNTGQLDNLL
PF01497         ---------------------------------------------------------Iaslspssteili


                         -         -         *         -         -         -         -:140
query           LLGITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
PF01497         aLgatd.klvgvdaktrdpldaekkpal.....siaevgadreidiEklaalkPDlvivsafgalvseie


                         +         -         -         -         -         *         -:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
PF01497         ellelgipvvavessstaeslleqirllgellgeedeaeelvaelesridavkaridslkpktvlvfgya


                         -         -         -         +         -         -         -:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
PF01497         degikvvfgsgswvgdlldaaggeni.iaeak..gseseeisaEqilaadpdviivsgrgedtktgveel


                         -         *         -         -         -         -         +:350
query           SNQAIPVDGDSWYLNASLVSAEIILQGLKDNVTV------------------------------------
PF01497         kenplwae--------------------------------------------------------------