[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55031.1


[Show Plain Result]

## Summary of Sequence Search
   1::365
   3::131  PF05103 0.0% 32.5  DivIVA protein 
 186::231  PF05103 0.0% 34.7826086956522  DivIVA protein 
 227::274  PF05103 0.0% 29.1666666666667  DivIVA protein 
 268::339  PF05103 0.0% 27.7777777777778  DivIVA protein 
   1::365


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQVAGGTSSAASS
PF05103         --ltpkDIknkeFkkkm...rGYdeeeVdeFLdqvikdyeallkeneelkeeieeleekleeykeleesl
PF05103         --ltpkDIknkeFkkkm...rGYdeeeVdeFLdqvikdyeallkeneelkeeieeleekleeykeleesl
PF05103         --ltpkDIknkeFkkkm...rGYdeeeVdeFLdqvikdyeallkeneelkeeieeleekleeykeleesl
PF05103         --ltpkDIknkeFkkkm...rGYdeeeVdeFLdqvikdyeallkeneelkeeieeleekleeykeleesl


                         -         -         *         -         -         -         -:140
query           STAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAKSAQDQLQRAQADAKAARDEA
PF05103         kkslvvaqetaeevkanakkeaeliikeaek......kaekiveeaeeeakkleteldelk---------
PF05103         kkslvvaqetaeevkanakkeaeliikeaek......kaekiveeaeeeakkleteldelk---------
PF05103         kkslvvaqetaeevkanakkeaeliikeaek......kaekiveeaeeeakkleteldelk---------
PF05103         kkslvvaqetaeevkanakkeaeliikeaek......kaekiveeaeeeakkleteldelk---------


                         +         -         -         -         -         *         -:210
query           EKAKAEAKAAASSNTTKAAAVGAVGAGTGAAVATGAANVDTHMQAAKVLGLAQEMADRLTSEARSESKSM
PF05103         ---------------------------------------------kkslvvaqetaeevkanakkeaeli
PF05103         ---------------------------------------------kkslvvaqetaeevkanakkeaeli
PF05103         ---------------------------------------------kkslvvaqetaeevkanakkeaeli
PF05103         ---------------------------------------------kkslvvaqetaeevkanakkeaeli


                         -         -         -         +         -         -         -:280
query           LDEAREAAEKQIEEANSTSNRTLEDARANAEKQIAEAQNRADTLVNEADAKAKNLISEAEKKSAATLAAS
PF05103         ikeaekkaekiveeaeeslkkslvvaqetaeevkanakkeaeliikeaekkaekiveeleeslkkslvva
PF05103         ikeaekkaekiveeaeeslkkslvvaqetaeevkanakkeaeliikeaekkaekiveeleeslkkslvva
PF05103         ikeaekkaekiveeaeeslkkslvvaqetaeevkanakkeaeliikeaekkaekiveeleeslkkslvva
PF05103         ikeaekkaekiveeaeeslkkslvvaqetaeevkanakkeaeliikeaekkaekiveeleeslkkslvva


                         -         *         -         -         -         -         +:350
query           TSRAEAQIRQAEDKANALQADAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELN
PF05103         qetaeevkanakkeaeliikeaekkaekiveeaeeeakkleteldelkrqsrlfrarfk-----------
PF05103         qetaeevkanakkeaeliikeaekkaekiveeaeeeakkleteldelkrqsrlfrarfk-----------
PF05103         qetaeevkanakkeaeliikeaekkaekiveeaeeeakkleteldelkrqsrlfrarfk-----------
PF05103         qetaeevkanakkeaeliikeaekkaekiveeaeeeakkleteldelkrqsrlfrarfk-----------


                         -         -         -         -         *         -         -:420
query           ARGSSAPTNNKPSGE-------------------------------------------------------
PF05103         ----------------------------------------------------------------------
PF05103         ----------------------------------------------------------------------
PF05103         ----------------------------------------------------------------------
PF05103         ----------------------------------------------------------------------