[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55227.1


[Show Plain Result]

## Summary of Sequence Search
   1::106
   2::103  PF06421 0.0% 71.5686274509804  GTP-binding protein LepA C-terminus 
   1::106


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
PF06421         -dalslivhkekaeergrelveklkeliprqqfevaiqaaigskiiaretikalrkdvlakcyggdvsrk


                         -         -         *         -         -         -         -:140
query           RKLLEKQKAGKKRMKNIGSVEVPQEAFVAALSTDEA----------------------------------
PF06421         kkllekQkegkkrmkkvgnveipqeaflavlkl-------------------------------------