[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55235.1


[Show Plain Result]

## Summary of Sequence Search
   1::196
 136::163  PF00633 0.0% 46.4285714285714  Helix-hairpin-helix motif 
 172::190  PF00633 0.0% 42.1052631578947  Helix-hairpin-helix motif 
  61::114  PF10531 0.0% 35.1851851851852  SLBB domain 
   1::196


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVNYPTPRFQISIKHGLIVCIILVVAFVGWFFTREKPVNPPTMAALAETYQTPAPSSQVVVSVVGHVAK
PF00633         ----------------------------------------------------------------------
PF00633         ----------------------------------------------------------------------
PF10531         ------------------------------------------------------------vvtVtGeVkr


                         -         -         *         -         -         -         -:140
query           PGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEVQPISVDAAATSASGLISLNT
PF00633         -----------------------------------------------------------------eglip
PF00633         -----------------------------------------------------------------eglip
PF10531         PgvyevpiGttlsdlleqAGGltddayrdsinltrlkaviagGp--------------------------


                         +         -         -         -         -         *         -:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP--------------
PF00633         asreeLlalPGVGpktAeaIlsy--------sreeLlalPGVGpktAeaI--------------------
PF00633         asreeLlalPGVGpktAeaIlsy--------sreeLlalPGVGpktAeaI--------------------
PF10531         ----------------------------------------------------------------------