[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55333.1


[Show Plain Result]

## Summary of Sequence Search
   1::499
   9::216  PF00743 0.0% 27.0531400966184  Flavin-binding monooxygenase-like 
 320::343  PF00743 0.0% 33.3333333333333  Flavin-binding monooxygenase-like 
  11::278  PF07992 0.0% 24.7126436781609  Pyridine nucleotide-disulphide oxidoreductase 
 304::363  PF07992 0.0% 26.6666666666667  Pyridine nucleotide-disulphide oxidoreductase 
  10::44   PF00070 0.0% 41.1764705882353  Pyridine nucleotide-disulphide oxidoreductase 
 175::214  PF00070 0.0% 23.0769230769231  Pyridine nucleotide-disulphide oxidoreductase 
   1::499


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTTEAIYKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
PF00743         --------kkvaviGaGvsGlas.ikccleegleptcfersddiGGlwrfkenveeGrasiyksvvsnss
PF00743         --------kkvaviGaGvsGlas.ikccleegleptcfersddiGGlwrfkenveeGrasiyksvvsnss
PF07992         ----------vviIGgGpaGlaaakrlarl.glkvaliere........pggtclnrgcipkkllleaae
PF07992         ----------vviIGgGpaGlaaakrlarl.glkvaliere........pggtclnrgcipkkllleaae
PF00070         ---------rvvvvGgGyiGlElAaalaklg.kkVtvierrdrl--------------------------
PF00070         ---------rvvvvGgGyiGlElAaalaklg.kkVtvierrdrl--------------------------


                         -         -         *         -         -         -         -:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
PF00743         kemscfsdfplpedypnflhnsklleylklfakefdllkyiqfkttvcsvkkrpdfstsGqwevvtekeg
PF00743         kemscfsdfplpedypnflhnsklleylklfakefdllkyiqfkttvcsvkkrpdfstsGqwevvtekeg
PF07992         ee....................eldlkeleerkdegievllntgvtdidkakkk..vel.adgkaevkyd
PF07992         ee....................eldlkeleerkdegievllntgvtdidkakkk..vel.adgkaevkyd
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
PF00743         kkesavfdavmvctGhhvnphlplesfpGiekfkGqyfhsrdykepevfkgkrvlviGlGnsggdiavel
PF00743         kkesavfdavmvctGhhvnphlplesfpGiekfkGqyfhsrdykepevfkgkrvlviGlGnsggdiavel
PF07992         klviAtGa..kprtlgipGvela.gkgvl..tsedalrlrekpkkvvvvGgGyigvelaaalakl.....
PF07992         klviAtGa..kprtlgipGvela.gkgvl..tsedalrlrekpkkvvvvGgGyigvelaaalakl.....
PF00070         ----------------------------------rvvvvGgGyiGlElAaalaklgkkVtvierrdrll.
PF00070         ----------------------------------rvvvvGgGyiGlElAaalaklgkkVtvierrdrll.


                         -         -         -         +         -         -         -:280
query           PRMERKYTDGEKRLFQRNPHVIENLRSELFWGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAK
PF00743         srtaeq----------------------------------------------------------------
PF00743         srtaeq----------------------------------------------------------------
PF07992         ....................................................tktllleklglelder--
PF07992         ....................................................tktllleklglelder--
PF00070         rald------------------------------------------------------------------
PF00070         rald------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LTPSYEPGCKRVLISNTYYPALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQ
PF00743         ---------------------------------------saifedgtveedidvvifatGytf-------
PF00743         ---------------------------------------saifedgtveedidvvifatGytf-------
PF07992         -----------------------egievllntgvtdidkakkkveladgkaevkydklviAtGakprtlg
PF07992         -----------------------egievllntgvtdidkakkkveladgkaevkydklviAtGakprtlg
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LIDGCDGLNLSEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQIEYILGAMDYMSAIGA
PF00743         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------
PF07992         ipGvelagkgvlt---------------------------------------------------------
PF07992         ipGvelagkgvlt---------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SIIEPTAEAEEAYVEHIQRNAVGTVWLDGGCNSWYVDQRTGRLTLIWPDFGYAFRDANGTFDAEGYEFRD
PF00743         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           VPATAPATL-------------------------------------------------------------
PF00743         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------