[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55378.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
 196::323  PF00107 0.0% 39.6825396825397  Zinc-binding dehydrogenase 
  27::154  PF08240 0.0% 36.7924528301887  Alcohol dehydrogenase GroES-like domain 
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPAVFGHEGAGVVVAV
PF00107         ----------------------------------------------------------------------
PF08240         --------------------------pgevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGive


                         -         -         *         -         -         -         -:140
query           GSAVTSVKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTF
PF00107         ----------------------------------------------------------------------
PF08240         evgegvkklkvGdrvvvepliscgeCeaCkegeenlc....................eeakllgvk..ld


                         +         -         -         -         -         *         -:210
query           ANYTNVSARSVVKVDDDVPLELLGPLGCGLSTGAGAILNSLGVRAGDTVAVFGTGAVGSAAIMAAAATGA
PF00107         -------------------------------------------------------GvGlaavqlAkalG.
PF08240         Ggfaeyvvvpekkl--------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTIIAVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
PF00107         arviavdsseeklelakelGadhvinskdedfvkaireltggkgvdvviecvgagatfeqalkllapgGr
PF08240         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAF
PF00107         vvvvggts.ganvefdlrklllkektiqGsllgnpeeleealq---------------------------
PF08240         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ADSASGEVIKPIITFP------------------------------------------------------
PF00107         ----------------------------------------------------------------------
PF08240         ----------------------------------------------------------------------