[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55454.1


[Show Plain Result]

## Summary of Sequence Search
   1::335
 167::287  PF00107 0.0% 26.890756302521  Zinc-binding dehydrogenase 
  37::95   PF08240 0.0% 33.8983050847458  Alcohol dehydrogenase GroES-like domain 
 159::210  PF01370 0.0% 32.6923076923077  NAD dependent epimerase/dehydratase family 
 159::255  PF00106 0.0% 28.735632183908  short chain dehydrogenase 
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFSEGPINSVVLTQDEDGNFSTAYQDTYSDPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP
PF00107         ----------------------------------------------------------------------
PF08240         ------------------------------------gevlvkvkaaGiCgsDlhivkgekelevklplil
PF01370         ----------------------------------------------------------------------
PF00106         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVGALGTAGFTA
PF00107         ----------------------------------------------------------------------
PF08240         GhEivGiveevgegvkklkvGdrvv---------------------------------------------
PF01370         ----------------------------------------------------------------------
PF00106         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE
PF00107         --------------------------GvGlaavqlAkalG.arviavdsseeklelakelGadhvinskd
PF08240         ----------------------------------------------------------------------
PF01370         ------------------ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdl
PF00106         ------------------vliTGGlgglGlalArwLvee.garhlvlvsrr.edapgaael.......ia


                         -         -         -         +         -         -         -:280
query           LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVD
PF00107         edfvkaireltggkgvdvviecvgagatfeqalkllapgGrvvvvggtsganvefdlrklllkektiqGs
PF08240         ----------------------------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF00106         elealgaevtvva.cDvadrdalaallaeirkelgpldgvvhaag-------------------------


                         -         *         -         -         -         -         +:350
query           APRELRRRAWALLSEHLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH---------------
PF00107         llgn.pe---------------------------------------------------------------
PF08240         ----------------------------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF00106         ----------------------------------------------------------------------