[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55467.1


[Show Plain Result]

## Summary of Sequence Search
   1::282
  25::200  PF01261 0.0% 19.3181818181818  Xylose isomerase-like TIM barrel 
   1::282


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADIGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVSQIPMNEENTAALERGISELGIEVGALSVAFGP
PF01261         ------------------------eaaaeaGfdgvElfgdglvpvseldeelrelrklldelglriasie


                         -         -         *         -         -         -         -:140
query           SAAPGVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNH
PF01261         fstrfayldedereardeekavaalkraielAkrlGaplvvvhpGgagagakgseaealerlaealnela


                         +         -         -         -         -         *         -:210
query           HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMEL
PF01261         eyaeeaGvklaiEnhpgegvedgyseelaalldavdspnvgvclDtgHliiagfdpddai----------


                         -         -         -         +         -         -         -:280
query           FTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFIEQDMTYGRDPFDCIKDSREYLTSI
PF01261         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GW--------------------------------------------------------------------
PF01261         ----------------------------------------------------------------------