[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55672.1


[Show Plain Result]

## Summary of Sequence Search
   1::455
   6::312  PF07992 0.0% 26.1111111111111  Pyridine nucleotide-disulphide oxidoreductase 
   6::41   PF00070 0.0% 29.4117647058824  Pyridine nucleotide-disulphide oxidoreductase 
 144::178  PF00070 0.0% 40  Pyridine nucleotide-disulphide oxidoreductase 
   7::43   PF01946 0.0% 37.1428571428571  Thi4 family 
 141::172  PF01946 0.0% 31.25  Thi4 family 
   1::455


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
PF07992         -----dvviIGgGpaGlaaakrlarl..glkvalierepggtclnrgcipkkllleaaeeeeldlkelee
PF00070         -----rvvvvGgGyiGlElAaal..aklgkkVtvierrdrl-----------------------------
PF00070         -----rvvvvGgGyiGlElAaal..aklgkkVtvierrdrl-----------------------------
PF01946         ------vvivGaGssGltaayylakk..dlkvailerklsiGG---------------------------
PF01946         ------vvivGaGssGltaayylakk..dlkvailerklsiGG---------------------------


                         -         -         *         -         -         -         -:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
PF07992         rkdegievllntgvtdidkakkkveladgkaevkydklviAtGa.kprtlgipGvela...gkg.vl.ts
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYESLAKNQAKEVHVFGRRGPAQAKFTPLELKEL
PF07992         edalrlrekpk....kvvvvGgGyigvelaaalakl..................................
PF00070         ---rvvvvGgGyiGlElAaalaklgkkVtvierrdrll--------------------------------
PF00070         ---rvvvvGgGyiGlElAaalaklgkkVtvierrdrll--------------------------------
PF01946         aesDvvivGaGssGltaayylakkdlkvaile--------------------------------------
PF01946         aesDvvivGaGssGltaayylakkdlkvaile--------------------------------------


                         -         -         -         +         -         -         -:280
query           DHSDTIEVIVNPEDIDYDAASEQARRDSKSQDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGK
PF07992         ......................................................................
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VVGLKTERTQLDGNGGVTGTGEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPI
PF07992         ..........tktllleklglelderGgivvd--------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TGLYATGWIKRGPIGLIGNTKSDAKETTEMLLADHAAGSLPAPAKPELESIIEFLDERKVAFTTWDGWHL
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LDAAERALGEPEGRERKKIVEWNDMVRHARPEYDI-----------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------
PF01946         ----------------------------------------------------------------------