[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55698.1


[Show Plain Result]

## Summary of Sequence Search
   1::266
   2::175  PF00795 0.0% 28.6585365853659  Carbon-nitrogen hydrolase 
   1::266


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
PF00795         -lvAsvqlpqgvaafdlednlpglllliaeaarygadlivlPElgitgyahwlglgatealelaetlrae


                         -         -         *         -         -         -         -:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
PF00795         vlaalsalarkagitviaGaaek....degg......lyntlvllsadgellgkyrkrhlvpfgmwqper


                         +         -         -         -         -         *         -:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL
PF00795         sllgeggatapvfdtpvvavaggklglliCyEilf-----------------------------------


                         -         -         -         +         -         -         -:280
query           PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL--------------
PF00795         ----------------------------------------------------------------------