[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55730.1


[Show Plain Result]

## Summary of Sequence Search
   1::441
  77::437  PF01546 0.0% 32.9192546583851  Peptidase family M20/M25/M40 
 191::336  PF07687 0.0% 30.8411214953271  Peptidase dimerisation domain 
   1::441


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLYDETLTLLQELIRNACVNDLTPDSGQEIRNAESLERFFEGTPNVEITKLEPRPGRTSIIVTVPGSDP
PF01546         ----------------------------------------------------------------------
PF07687         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NAEPLTLLGHTDVVPVDLPKWTKDPFGAEISDGQIWGRGSVDMLFITATQAAVTRQVAREGGLRGTLTFV
PF01546         ------lrgHmDvVpe.enkwk............lygrGaddmkggllaalaalealaeagtklkgtvel
PF07687         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GVADEEARGGLGAKWLSEEHQNLFSWKNCLSESGGSHLPVHDGSDAVVINVGEKGAAQRRIHVNGDAGHG
PF01546         lftpdEEggsrggakaliea.................alglh..idlgivgepseedg............
PF07687         --------------------------------------------------ighkGlaggkitvkgkagHs


                         -         -         -         +         -         -         -:280
query           SIPFDRDSAIVKIGEVARRIAAADLKVAKDDIWQGFVQAHRFDPETEQALLSGTSPEAYAEFGGLSRFAH
PF01546         ......................................................................
PF07687         gapgaganAieklarllqsledeegpia.......................................eer


                         -         *         -         -         -         -         +:350
query           AVSHLTIAQTVVRAGQAINVLPSHAYLELDIRTLPGQTNDYVDDTLRGALGDLADEVEIEHLISEEATVS
PF01546         ......................................................................
PF07687         slgrttlnvtgiegGtaknvipdeaeakidiRllpgedpeevlkeieeilekeape--------------


                         -         -         -         -         *         -         -:420
query           PTDSRLYNTLEKVLGDFFPDAPVVPIISSGGSDLRFGRRLGGVGYGFAVHARERTLAEAMGQLHSHDEAL
PF01546         .......tendaelvqalekaaeelgl..kveplvsgggtdasfiar.vglgfpmiglgpgn......gt
PF07687         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YLEDLELTVRGYDSVVREFLG-------------------------------------------------
PF01546         aHspnEkvdlddlekgi-----------------------------------------------------
PF07687         ----------------------------------------------------------------------