[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF55908.1


[Show Plain Result]

## Summary of Sequence Search
   1::165
  18::158  PF00210 0.0% 24.0875912408759  Ferritin-like domain 
   1::165


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
PF00210         -----------------ikaLneqlndelaasyqYlamaayfegvglpgfakffkeqadeerehadklae


                         -         -         *         -         -         -         -:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
PF00210         rilklggkpeltrvelkeikkpae....wgdvlealeaalelekevtkslreliklaeeekDpatadfle


                         +         -         -         -         -         *         -:210
query           QAAELEKFQWFIRAHIVDVDGNIQE---------------------------------------------
PF00210         efleeqeehikelagllt----------------------------------------------------