[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF52967.1


[Show Plain Result]

## Summary of Sequence Search
   1::684
 438::679    1e-85 55.5% 0035588 00355881 1/1   II DNA topoisomerase                    
   7::218  1.4e-67 51.7% 0043464 00434641 1/1   e domain of HSP90 chaperone/DNA topoiso 
   6::215  1.3e-60 47.6% 0037015 00370151 1/1   e domain of HSP90 chaperone/DNA topoiso 
 265::436  1.9e-59 47.7% 0040104 00401041 1/1   omal protein S5 domain 2-like           
   8::212  2.1e-59 43.9% 0042491 00424911 1/1   e domain of HSP90 chaperone/DNA topoiso 
 265::436  2.5e-59 47.7% 0037014 00370141 1/1   omal protein S5 domain 2-like           
  12::213  6.1e-59 43.1% 0040105 00401051 1/1   e domain of HSP90 chaperone/DNA topoiso 
 264::430    9e-58 48.2% 0043463 00434631 1/1   omal protein S5 domain 2-like           
 261::425  9.8e-56 46.8% 0042490 00424901 1/1   omal protein S5 domain 2-like           
  33::219  6.6e-52 52.1% 0043462 00434621 1/1   e domain of HSP90 chaperone/DNA topoiso 
   9::277    5e-39 33.7% 0035364 00353641 1/1   e domain of HSP90 chaperone/DNA topoiso 
  32::209    7e-37 32.7% 0038465 00384651 1/1   e domain of HSP90 chaperone/DNA topoiso 
  16::208  1.8e-33 26.8% 0048223 00482231 1/1   e domain of HSP90 chaperone/DNA topoiso 
   8::209  1.2e-28 23.2% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
  18::274  1.6e-24 23.1% 0043038 00430381 1/1   e domain of HSP90 chaperone/DNA topoiso 
  13::210  5.9e-17 16.1% 0044566 00445661 1/1   e domain of HSP90 chaperone/DNA topoiso 
  16::225  2.6e-14 22.8% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
  18::143  1.2e-09 20.0% 0039624 00396241 1/1   e domain of HSP90 chaperone/DNA topoiso 
  13::211  3.9e-08 18.5% 0053133 00531331 1/1   e domain of HSP90 chaperone/DNA topoiso 
  38::138  0.00082 19.8% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
   1::684


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEDGG
00355881   1/1  ----------------------------------------------------------------------
00434641   1/1  ------rylaesiqvlialeevlerpgmyigst...gllrvvkelvdNAidaalaggavrievtldddgs
00370151   1/1  -----ldelledliavlkglelvlkrpgmlilvtgdatglyrvvqelldNAidhalaggavtisvtldgd
00401041   1/1  ----------------------------------------------------------------------
00424911   1/1  -------ylvedllvlsrleavrlrpdmyigllelaeekgivleleldellllvlgdvegllqillelld
00370141   1/1  ----------------------------------------------------------------------
00401051   1/1  -----------kievlgillavrlrpgliivsgdverlaqvlkeLldNAidaapaggavtirvtldddgs
00434631   1/1  ----------------------------------------------------------------------
00424901   1/1  ----------------------------------------------------------------------
00434621   1/1  --------------------------------evveglahvvkelvdNAidaalagkatrievtleadgs
00353641   1/1  --------fqaeikvlldleavllaagedier.....laqvlreLvdNAidag....agrievsle.dgg
00384651   1/1  -------------------------------gedierlasvlkeLvdNAidag....atrievtle.dgg
00482231   1/1  ---------------lkilelvrkpplpiivggdprrleqvlrnLvsNAidatakggvivivvilvivis
00357841   1/1  -------lelkaiaeklgielevdrlldilagslysnleivlrELisNAiDAlaklrlilltdeklageg
00430381   1/1  -----------------laesiqfqveierlldilinadysrleqvlrELiqNAiDAgatrveisledeg
00445661   1/1  ------------eaeklefqleverlldilvgslysnleivlrELisNAiDAlaklvylsltdgkltleg
00439391   1/1  ---------------lniqlevdglldilig.sdysrleqvlreLisNAiD.Alaklvlllltdgkklae
00396241   1/1  -----------------gielvldldplllvlgdplrlrqvllnLlsNAikatpeggleslllptitvsl
00531331   1/1  ------------lleklefqveverlldllikslysnleivlrELisNAiDAlaklvylsltdekllgeg
00381461   1/1  -------------------------------------lrqvllnLlsNAikatpegleegklelgtitvs


                         -         -         *         -         -         -         -:140
query           VQVVDDGRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK
00355881   1/1  ----------------------------------------------------------------------
00434641   1/1  isVeDdGrGipvdilpkifepfveliltvlhagskfddlsykvsgglhGlGlsvvnalsellggtvtrdg
00370151   1/1  gsisVeDdGrGippeileriferfyelvltvlhagskfdddsykvsggghGlGlsivnalsellggtitr
00401041   1/1  ----------------------------------------------------------------------
00424911   1/1  NAidhalagpgairikvtldgdgvsieVeDnGrGIpveilekifepffeliltvlhaggkfdddsykvsg
00370141   1/1  ----------------------------------------------------------------------
00401051   1/1  ltVeDnGrGippedlprlferfytskltvllaggkfddlsykvsggghGlGlsivnalsellggtitvds
00434631   1/1  ----------------------------------------------------------------------
00424901   1/1  ----------------------------------------------------------------------
00434621   1/1  ieViDnGrGipvdilpl......................ykvsgglhGvGlsvvnalsellggtvtrdgk
00353641   1/1  lvlitVrDnGiGipeddlpr........lferfatskissfddlsyivsiGgrGlGlasvralaelvivt
00384651   1/1  lllieVsDnGiGipeedlek........lferfatskisgfddlssrvtlGfrGlGlasvkalsellggt
00482231   1/1  edgglvritVsDnGiGIppeelpk..........iferfatskiksfsrliggtGlGlsivkllselhgg
00357841   1/1  geitirllpdkeeltltvsDnGiGitkedlin.......ifgtfatsgkkgfleylvdgsdvsliggfGl
00430381   1/1  klgengeitikiladkenvlitvtDnGiGiteedlpkiferfatskkkeflellhagggtdlssrktiGg
00445661   1/1  geiririlldkdnltltvsDnGiGitked.......lekifgtfatskkkgfleklsdladidliGgfGl
00439391   1/1  ggeitirikldkdnvlltvtDnGiGiteedlkkifepfatsktkgflealkaggkedlsdirligg.fGl
00396241   1/1  rldgdlvvisvsDnGiGipeell....erifepfyrtkssrsldsslrklgG..tGLGLaivkrivelhg
00531331   1/1  geilirilpdkdavtltirDnGiGmtkedlek.......ilgtiatsgkkgfleklddkadrsliGqfGl
00381461   1/1  lrlegdlvvisvsDnGiGippedlerifepffttkeaglsdlellnllllpglslaslvrdlgGtGlG--


                         +         -         -         -         -         *         -:210
query           HWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIFETTEFDFETISRRLQEMAFLNKGLTITLTDNRAT
00355881   1/1  ----------------------------------------------------------------------
00434641   1/1  kvytqlfedgvpvaplkvigetdapgtGttvtfkpplkifkttefeydtlakrlrelaflnpgvkitlnd
00370151   1/1  dgkvytqlfergvpvaplkvvgstpggGttvtfrlpleiflettefeletllkrlrelaflnpgvkitln
00401041   1/1  ----------------------------------------------------------------------
00424911   1/1  ggtGlGlsivnalsellggtvevksggttftitlplgmpvasllvigdlkkgkdgTtvtflPdleifetl
00370141   1/1  ----------------------------------------------------------------------
00401051   1/1  kvytqlfsdggpviplkvigelkspggGttvtvtlpleifettefeydtlldrlrelallnpgvkitltd
00434631   1/1  ----------------------------------------------------------------------
00424901   1/1  ----------------------------------------------------------------------
00434621   1/1  vylqlfsrgvpvaplevigetdaggtgttvtfkpdlkifkttefeldtladrlrelAflnpgvkitltde
00353641   1/1  rtadgkvatrlfsahggtitvespaapgrGttvtltlpfynlpvrrkilkseklelarlldllreyalln
00384651   1/1  itrdgkvatrlfldggglesllvpsapgkGttvtvrlpfynlpvrrkeflkslktellklldllrrlal-
00482231   1/1  eitvesepgggstftitlplgilrgtepvlllkgttvevldlfvnfplrlkilkdikfeielllellr--
00357841   1/1  GlysvfaladkvtvttrsdgeeavrwlsllggtitveeilgselgrGTtitltlpldkle.....flel-
00430381   1/1  .fGlGlssvfsvsdevevttktngdeakkivedhggtitveiplgse.lgkGTtvtltlpednleylepa
00445661   1/1  GlysvfavadkvtvltrsagdeaalvlsllggsitvesepaeklgrGTtitl.....tlpldkleflell
00439391   1/1  GlasvflvadkvtvttrsngseaalwvellggtitveseeglalgrGTtitltlpldale.....fleil
00396241   1/1  gti-------------------------------------------------------------------
00531331   1/1  GlysvflvadkvtvisrsagdeayvwesdgggsftieeievesklgrGTtitlhlpedale...fleelr
00381461   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DEELELEALAEQGETATELSLDEIDNETELVEETTDAPKKPKKREKKKIFHYPNGLEDYVQYLNRSKTNI
00355881   1/1  ----------------------------------------------------------------------
00434641   1/1  erlelldf--------------------------------------------------------------
00370151   1/1  derlg-----------------------------------------------------------------
00401041   1/1  ------------------------------------------------------Glkdyvelllkdkell
00424911   1/1  ef--------------------------------------------------------------------
00370141   1/1  ------------------------------------------------------Glkdyvelllkdkell
00401051   1/1  erl-------------------------------------------------------------------
00434631   1/1  -----------------------------------------------------gGlkdyvelllkdkell
00424901   1/1  --------------------------------------------------vylnGlklfvkelnkykell
00434621   1/1  rlgllelfl-------------------------------------------------------------
00353641   1/1  pgvpitltd..............................................egkllllllyeg---
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  rlkflks.kyaeflnlpilillldlslpelefke................liellndlsllllv------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  rllellakyspfigf-------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  l---------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
00355881   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00401041   1/1  leepiyivgekdgirvevalqwsdgysenilsfvNniptteGGthvngfrdaltralneyakklgllkkk
00424911   1/1  ----------------------------------------------------------------------
00370141   1/1  leepiyivgekdgirvevalqwsdgysenilsfvNniptteGGthvdgfrdaltralneyakkkgllkkk
00401051   1/1  ----------------------------------------------------------------------
00434631   1/1  leeviyiegelegirvevalqwsdsygefqilsfvNniptteGGthvdgfrdaltralneyaekknllkk
00424901   1/1  lkeiiylegellllvlekdgirvevalqwsdgy.enivsfvNnipTteGGtHvdgfrdaltralneyak.
00434621   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
00355881   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00401041   1/1  kvkltgddvregltavvsvkipePqFegQTKekLgssevrflveslvsekllkfllenpelaklilekvl
00424911   1/1  ----------------------------------------------------------------------
00370141   1/1  kvkltgddvregltavvsvkipnPqFegQTKekLgssevrflvesvvsekllkfllenpelaklilekvl
00401051   1/1  ----------------------------------------------------------------------
00434631   1/1  .kvklkgddvregltavvsvkvpePqFegQTKekLgssevrflveslvsekllkfllenpeiaklileka
00424901   1/1  ....kkkkvklkgddvregltavvsvkipnPqFegQTKekLgssevrflvesvvsekllkfllenp....
00434621   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPL
00355881   1/1  -----------------rkslllgipllgkladagskdsekceLflvEGdSAggsakqgrsvvdrdfqav
00434641   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00401041   1/1  laakareaarkarelt------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00370141   1/1  laakareaarkarelt------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00434631   1/1  llaakarlaa------------------------------------------------------------
00424901   1/1  .ivek-----------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
00355881   1/1  lPLrGkilNvrkasldkilkneeiqnlitalGlgigkeyfdleklrYgkiiimtDaDvDGshIktLlltf
00434641   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00401041   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00370141   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00434631   1/1  ----------------------------------------------------------------------
00424901   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           MPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASEL
00355881   1/1  flrympsllelngflyiaipPlykvtkgkkkkkviyfysleeleellkelgnl.....kkleikryKGLG
00434641   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00401041   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00370141   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00434631   1/1  ----------------------------------------------------------------------
00424901   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           WETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNAKDVRFLDI----------------
00355881   1/1  emnpeelkettmdletrlllfvtlddade.eliflalmgkkvedrkewl---------------------
00434641   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00401041   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00370141   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00434631   1/1  ----------------------------------------------------------------------
00424901   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------