[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53009.1


[Show Plain Result]

## Summary of Sequence Search
   1::190
  19::189  2.9e-60 50.9% 0050386 00503861 1/1   philin-like                             
   1::189    1e-57 45.9% 0051523 00515231 1/1   philin-like                             
  22::189  2.4e-57 57.4% 0051587 00515871 1/1   philin-like                             
  11::189  2.6e-56 51.2% 0052109 00521091 1/1   philin-like                             
   6::188  5.4e-56 51.2% 0051928 00519281 1/1   philin-like                             
  11::190    2e-55 51.5% 0051132 00511321 1/1   philin-like                             
  14::188  4.8e-54 46.7% 0042879 00428791 1/1   philin-like                             
  18::190  7.2e-54 52.9% 0050106 00501061 1/1   philin-like                             
  14::188  2.2e-53 47.0% 0034847 00348471 1/1   philin-like                             
  21::189  2.4e-53 53.3% 0052763 00527631 1/1   philin-like                             
  13::189  5.1e-53 51.2% 0051693 00516931 1/1   philin-like                             
  10::189  5.5e-53 46.7% 0045440 00454401 1/1   philin-like                             
  14::188  6.9e-53 47.0% 0036678 00366781 1/1   philin-like                             
  11::188  1.6e-52 44.6% 0042900 00429001 1/1   philin-like                             
  14::190  2.5e-52 50.9% 0050399 00503991 1/1   philin-like                             
  23::188  9.6e-52 54.1% 0040592 00405921 1/1   philin-like                             
  22::189    1e-51 54.3% 0051149 00511491 1/1   philin-like                             
   1::189  1.8e-51 44.1% 0039026 00390261 1/1   philin-like                             
  12::189  4.9e-51 52.5% 0051043 00510431 1/1   philin-like                             
  11::189  9.5e-51 47.6% 0038362 00383621 1/1   philin-like                             
  24::190    4e-50 54.3% 0051558 00515581 1/1   philin-like                             
  15::190  1.3e-49 52.5% 0051982 00519821 1/1   philin-like                             
  11::189  1.9e-49 52.2% 0052507 00525071 1/1   philin-like                             
  17::188    3e-49 51.3% 0039184 00391841 1/1   philin-like                             
  16::189  3.1e-49 51.3% 0052158 00521581 1/1   philin-like                             
  12::189  3.6e-49 47.2% 0036200 00362001 1/1   philin-like                             
   1::190


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEG
00503861   1/1  ------------------vfldiviletslGdivieLfgdlaPktvenFlalakgekglgklgklellke
00515231   1/1  llllllllllllllltplvfldivilgtslGrivieLfadvaPktvenFlalakggfglg.......gkl
00515871   1/1  ---------------------pkvlldtslGdivieLfpdlaPktvenFlalakgg..............
00521091   1/1  ----------llllvlplvfldiviletslGrivieLfadlaPktvenFlalvkggkg............
00519281   1/1  -----lllllllllllllklnplvlldtslGdivieLfgdlaPktvenFlalvkggf.............
00511321   1/1  ----------llllllllklnplvlldtslGdivieLfgdlaPktvenFlalvkgg..............
00428791   1/1  -------------llnplvfldiviletslGrivieLfadvaPktvenFlalctgelgll......llks
00501061   1/1  -----------------lkgnplvlletslGdivieLfgdlaPktvenFlalvkgg..............
00348471   1/1  -------------lllpvvfldiviletnlGrivieLfadvaPktvenFlalctgel....llgllllks
00527631   1/1  --------------------nllvlldtslGdivieLfadlaPktvenFlalvkgg..............
00516931   1/1  ------------llllplvfldiviletslGrivieLfadlaPktvenFlalvkgg..............
00454401   1/1  ---------llllllnpvvfldivilgtslGrivieLfadvaPktvenFlalctggkg............
00366781   1/1  -------------llnplvfldiviletnlGrivieLfadvaPktvenFlalctggkgl.....glllll
00429001   1/1  ----------llllllplvfldiviletslGrivieLfadvaPktvenFlalctggfglg.......gkl
00503991   1/1  -------------llnplvfldiviletslGrivieLfadlaPktvenFlalakge............ke
00405921   1/1  ----------------------tvlldtslGdivieLfadlaPktvenFlklvkggf.............
00511491   1/1  ---------------------llvlletslGdivieLfadlaPktvenFlalakgg..............
00390261   1/1  lllllllllllllnpvvfldi..vilgtslGrivieLfadvaPktvenFlalctgekglgllvkl....k
00510431   1/1  -----------llllnplvfldiviletslGrivieLfadlaPktvenFlalakg............gkg
00383621   1/1  ----------lllllnplvfldiviletslGrivieLfadvaPktvenFlalctggkg............
00515581   1/1  -----------------------lnplvfldiviletslGrivieLfgdlaPktvenFlalvkggkg...
00519821   1/1  --------------lnplvfldiviletslGrivieLfgdlaPktvenFlalakggkg............
00525071   1/1  ----------lllllnplvfldiviletslGrivieLfgdlaPktvenFlalakggkg............
00391841   1/1  ----------------plvyldiviletslGrivieLfadlaPktvenFlalctggkg............
00521581   1/1  ---------------nplvfldiviletslGrivieLfadlaPktvenFlalvkggkg............
00362001   1/1  -----------llllnplvfldivilgtslGrivieLfadvaPktvenFlalctg............gkg


                         -         -         *         -         -         -         -:140
query           PFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTP
00503861   1/1  gfYdgtiFhRvipgfmiqgGdptgggesiygykfedeffnglkhnkrgtlamanagpntngsqFfItlad
00515231   1/1  llYdgtiFhRvipgfmiqgGdptlgtgtggesiygekfedeffn.llhnkrgtlsmanagpnsngsqFfI
00515871   1/1  .fYdgtifhrvipgfmiqgGdptgdgtggesiygypfedeffpnllhnrrgtlsmanagpnsngsqFfit
00521091   1/1  lfYdgtifhRvipgfmiqgGdptlgtgtggesiygekfedeffn.llhnkrgtlsmanagpntngsqFfI
00519281   1/1  ..YdgtifhRvipgfmiqgGdptgdgtggesiygytfedefnflllhnkrgtlsmanagpnsngsqFfit
00511321   1/1  .fYdgtifhrvipgfmiqgGdptgdgtggesiygytfedelnfnllhnkrgtlsmanagpnsngsqFfit
00428791   1/1  gfYdgtiFhrvipgfmiqgGdptsgngtggesiygekfedenfv.lkhnkrgtlsmanagpntngsqFfi
00501061   1/1  .fYdgtifhrvipgfmiqgGdptgtgggsiygakfedeffn.llhnkrgtlamansgdpnsngsqFfitl
00348471   1/1  gfYdgtiFhrvipgfmiqggdptlgngtggesiygekfeden.fvlkhnkrgllsmanagpntngsqFfi
00527631   1/1  .fYdgtifhrvikgfmiqgGdptgdgtggesiygekfedeffnlllhnkrgtlamanagpnsngsqFfit
00516931   1/1  .fYdgtifhrvikgfmiqgGdptgdgtggesiygekfedeffnlllhnkrgtlsmanagpnsngsqFfit
00454401   1/1  lfYdgtifhRvipgfmiqgGdptsgngtggesiygekfedenfi.lkhnkrgtlsmanagpntngsqFfi
00366781   1/1  lfYdgtifhrvipgfmiqgGdptlgngtggesiygekfedenfv.llhnkrgtlsmanagpntngsqFfi
00429001   1/1  llYdgtiFhrvipgfmiqgGdptsgngtggesiygekfedenfv.lkhnkrgllsmanagpntngsqFfi
00503991   1/1  gfYdgtifhRvipgfmiqgGdptlgtgtggesiygekfedeffn.llhnkrgtlsmanagpnsngsqFfI
00405921   1/1  ..YdgtifhrvipgfmiqgGdptgtgggsiygekfeden.fvllhnkrgtlamanaggpnsngsqFfitl
00511491   1/1  .fYdgtifhrvipgfmiqgGdptgdgtggesiygekfedeffnlllhnrrgtlsmanagpnsngsqFfit
00390261   1/1  gfYdgtiFhRvipgfmiqgGdptlgngtggesiygekfeden.fvlkhnkrgtlsmanagpntngsqFfI
00510431   1/1  lfYdgtifhRvipgfmiqgGdptlgtgtggesiygekfedeffg.lkht.rgtlsmanagpntngsqFfi
00383621   1/1  lfYdgtiFhRvipgfmiqggdptsgngtggesiygekfedenfv.lkhnkrgtlsmanagpntngsqFfi
00515581   1/1  .........lfYdgtifhRvipgfmiqgGdptlgtgtggesiygekfedeffn.llhnkrgtlsmanagp
00519821   1/1  lfYdgtifhRvipgfmiqgGdptlgtgtggesiyglkfedeffn.llhnkrgtlsmanagpnsngsqFfi
00525071   1/1  lfYdgtiFhRvipgfmiqgGdptagtgtggesiygekfedeff.nllhnkrgtlsmanagpnsngsqFfi
00391841   1/1  lfYdgtifhrvipgfmiqggdptlgtgtggesiygekfedenfv.llhnkrgtlsmanagpntngsqFfi
00521581   1/1  lfYdgtifhrvipgfmiqgGdptlgtgtggesiygekfedeffn.llhnkrgtlsmanagpnsngsqFfI
00362001   1/1  lfYdgtiFhrvipgfmiqgGdptsgngtggesiygekfeden.fvlkhnkrgtlsmanagpntngsqFfi


                         +         -         -         -         -         *         -:210
query           TPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESVEITA--------------------
00503861   1/1  tphldgkytvfGkVvegdsmdvvdkiekvetdsndrplepvvilsvgvl---------------------
00515231   1/1  tladtphldgkytvfGkVveGmdllvvdkiekvgtdslndrPlkpvvil---------------------
00515871   1/1  lgdaphldgkytvfGkVv..eGmdvvdkiekvptdglgdrplepvvIls---------------------
00521091   1/1  tlgdtphldgkytvfGkVveGelmdvvdkieavgtdelgdrplkpvvil---------------------
00519281   1/1  ladtphldgkytvfGkVv..eGmdvvdkieavetdsndrplepvvils----------------------
00511321   1/1  ladtphldgkytvfGkVv..eGmdvvdkieavetdsndrplepvvilsvg--------------------
00428791   1/1  tladtpfldgkyvvfGkVveg..mdvvdkienvgtdn.grplkpvvIl----------------------
00501061   1/1  adtplldlslldgkytvfGkVv..eGmdvvdkiekvptdsnlllldrple--------------------
00348471   1/1  tladtpfldgkyvvfGkVv..eGmdvvdkienvgtdkngrplkpvvIl----------------------
00527631   1/1  ladtplldgkytvfGkVv..eGmdvvdkiekvetdsndvplepvvilsv---------------------
00516931   1/1  ladtphldgkytvfGkVv..eGmdvvdkieavetdslndrplepvvils---------------------
00454401   1/1  tladtpwldgkyvvfGkVveG..mdvvekienvgtdkngrplkpvvIls---------------------
00366781   1/1  tladtpfldgkyvvFGkVv..eGmdvvekienvgtdn.gkplkpvvIl----------------------
00429001   1/1  tladtpfldgkyvvfGkVveG..mdvvekienvgtdengrplkpvvIl----------------------
00503991   1/1  tladtplldgkytvfGkVv..eGmdvvdkieavgtd.ndvplkpvvilsv--------------------
00405921   1/1  adtpfldlsglsllggkytvFGkVv..eGmdvldkiekvdtdsnglll----------------------
00511491   1/1  ladaplldgkytvFGkVv..eGmdvvdkiekvptldsndrplepvvils---------------------
00390261   1/1  tladtpwldgkyvvfGkVveG..mdvvekienvgtdn.grplkpvvils---------------------
00510431   1/1  tlgdtphldgkytvfGkVv..eGmdvvdkiekvgtdsngrplkpvvils---------------------
00383621   1/1  tladtpwldgkyvvfGkVv..eGmdvvekieavgtdengrplkpvvIls---------------------
00515581   1/1  nsngsqFfitladtplldgkytvfGkVve..Gmdvvdkieavgtd.ndvp--------------------
00519821   1/1  tladtplldgkytvfGkVv..eGmdvvdkiekvgtd.ndvPlkpvvilsv--------------------
00525071   1/1  tlgdtphldgkytvFGkVve..GmdvvdkiekvgtdkngrplkpvvIls---------------------
00391841   1/1  tladtplldgkyvvfGkVv..egmdvvdkienvgtd.ngrplkpvvIl----------------------
00521581   1/1  tladtplldgkytvfGkVve..Gmdvvdkiekvgtd.ndvPlepvvils---------------------
00362001   1/1  tladtpwldgkyvvfGkVv..eGmdvvekieavgtdkngrplkpvvIld---------------------