[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53115.1


[Show Plain Result]

## Summary of Sequence Search
   1::383
 231::378  1.2e-22 25.0% 0046085 00460851 1/1   uclease H-like                          
 226::385  7.5e-18 23.4% 0046055 00460551 1/1   uclease H-like                          
 233::378  3.8e-07 23.2% 0035416 00354161 1/1   uclease H-like                          
 219::376  1.4e-05 21.1% 0045815 00458151 1/1   uclease H-like                          
  61::103     0.13 37.2% 0046966 00469662 2/2   domain-like                             
   5::49      0.36 30.0% 0046966 00469661 1/2   domain-like                             
   6::45      0.42 25.0% 0048742 00487421 1/3   domain-like                             
 115::166     0.45 21.2% 0048742 00487423 3/3   domain-like                             
  59::101      1.2 37.2% 0048742 00487422 2/3   domain-like                             
   1::383


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKIGRPGLPQDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSILLPRGGIYLPAQKHHPGTLTLAEREE
00460851   1/1  ----------------------------------------------------------------------
00460551   1/1  ----------------------------------------------------------------------
00354161   1/1  ----------------------------------------------------------------------
00458151   1/1  ----------------------------------------------------------------------
00469662   2/2  ------------------------------------------------------------Grkklldree
00469661   1/2  ----Grkklld..reevlelleeGlslteiakelgisrstvyrilkele---------------------
00487421   1/3  -----llrvnqlgglfvmgrplsvelRlkivllaaeGlspreiar-------------------------
00487423   3/3  ----------------------------------------------------------------------
00487422   2/3  ----------------------------------------------------------llrvnqlgglfv


                         -         -         *         -         -         -         -:140
query           ISRGLSVGLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVA
00460851   1/1  ----------------------------------------------------------------------
00460551   1/1  ----------------------------------------------------------------------
00354161   1/1  ----------------------------------------------------------------------
00458151   1/1  ----------------------------------------------------------------------
00469662   2/2  vlelleeGlslteiakelgisrstvyrilkele-------------------------------------
00469661   1/2  ----------------------------------------------------------------------
00487421   1/3  ----------------------------------------------------------------------
00487423   3/3  --------------------------------------------llrvnqlgglfvmgrplsvelRlkiv
00487422   2/3  mgrplsvelRlkivllaaeGlspreiarrlg---------------------------------------


                         +         -         -         -         -         *         -:210
query           ARLREDWSPEQIAGRLKITYACTSRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQ
00460851   1/1  ----------------------------------------------------------------------
00460551   1/1  ----------------------------------------------------------------------
00354161   1/1  ----------------------------------------------------------------------
00458151   1/1  ----------------------------------------------------------------------
00469662   2/2  ----------------------------------------------------------------------
00469661   1/2  ----------------------------------------------------------------------
00487421   1/3  ----------------------------------------------------------------------
00487423   3/3  llaaeGlspreiarrlgvsrstvskw--------------------------------------------
00487422   2/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WRSQIKDAVSISKRPKEAEARVQVGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIR
00460851   1/1  --------------------daPnelwhiDltgl.gkkyllvvvDdfsryvvayplksetaelvakflle
00460551   1/1  ---------------gplfratrpnelwhiDitplptsggklyllvviDdfsryvvayplksktaelvak
00354161   1/1  ----------------------alglWqmdvthlgnk.yilvavdtfsgfvwatllksetakvvkkflle
00458151   1/1  --------llrlfratrpnelwhiDit.gpptlg.grkyllvviDdfsryvvaiplssltaelvakaler
00469662   2/2  ----------------------------------------------------------------------
00469661   1/2  ----------------------------------------------------------------------
00487421   1/3  ----------------------------------------------------------------------
00487423   3/3  ----------------------------------------------------------------------
00487422   2/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ELGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFS
00460851   1/1  iiarfg...pkvihsDnGseFtskefkellaelgikhsfsrpytPqqnGvvErfnrtlkeelrklllsle
00460551   1/1  alkriiarfgvp..kvihsDnGseftskafqellkelgikhsfsrpytpqqngvvErfnrtlkeelrkll
00354161   1/1  laarfg...vkvlrtDnGpeftskefeefckelgikhttgiPynPqsnGvvEraNrtlkellkkllleak
00458151   1/1  afarfg..vpkiihsDnGseFtskafrellaelgikhslsrpgnpqdngvvErfnrtlkeelrklllfas
00469662   2/2  ----------------------------------------------------------------------
00469661   1/2  ----------------------------------------------------------------------
00487421   1/3  ----------------------------------------------------------------------
00487423   3/3  ----------------------------------------------------------------------
00487422   2/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           QTDLDQVADKLNNRPRKVLGFRTPAEQYEALLR-------------------------------------
00460851   1/1  ewrealltalylynrrphsslggltPae------------------------------------------
00460551   1/1  lesglglllpleewrealptalyayNrrphsslg.-----------------------------------
00354161   1/1  fweealslalyllnrlplgglggltPye------------------------------------------
00458151   1/1  .......liefynhrrwhealgtatp--------------------------------------------
00469662   2/2  ----------------------------------------------------------------------
00469661   1/2  ----------------------------------------------------------------------
00487421   1/3  ----------------------------------------------------------------------
00487423   3/3  ----------------------------------------------------------------------
00487422   2/3  ----------------------------------------------------------------------