[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53177.1


[Show Plain Result]

## Summary of Sequence Search
   1::136
   1::118  9.4e-46 58.5% 0048798 00487981 1/1   ike                                     
   1::123  2.3e-45 56.6% 0044362 00443621 1/1   ike                                     
   1::136


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNIC
00487981   1/1  mlrtllkaklhratvteadlnyeGsitidedlleaagilelekvdivnvnnGerletYvilgergsgvil
00443621   1/1  mlrtllkaklhratvteadlnYvGsitidedlleaagilelekvdivnvnnGeRfetYvikge.gsgvis


                         -         -         *         -         -         -         -:140
query           INGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI----
00487981   1/1  lnGaaarlvqvGdlviilayalldeeelkelkPkvvlvdedneilell----------------------
00443621   1/1  lnGaaarlvqvGDlviilayalldeeelkslkPkvvlvdedneilellslepv-----------------