[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53444.1


[Show Plain Result]

## Summary of Sequence Search
   1::302
 120::303  7.9e-34 35.4% 0049552 00495521 1/1   -like ATPase domain                     
 121::303  2.8e-33 35.6% 0049808 00498081 1/1   -like ATPase domain                     
   1::119  7.2e-25 36.4% 0049807 00498071 1/1   -like ATPase domain                     
   1::118  1.9e-24 35.9% 0049551 00495511 1/1   -like ATPase domain                     
   1::302


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLAKTLGCAELMP
00495521   1/1  ----------------------------------------------------------------------
00498081   1/1  ----------------------------------------------------------------------
00498071   1/1  lGsnsirlliaevlggg.lrvllslkvivrlgegldetgllseeaieralaalkrfaelledlgvedvra
00495511   1/1  lllllAviDlGsnsirlliadllggs.lrillllkvivrlgegldedgllseeaieraleaLkrfkellk


                         -         -         *         -         -         -         -:140
query           FATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGT
00495521   1/1  -------------------------------------------------segnglvvDiGGGStElilgd
00498081   1/1  --------------------------------------------------dggglvvDiGGGStElilgs
00498071   1/1  vATsalReAkNgeefldrveeelgleievisgeeEarliylgvlslldl---------------------
00495511   1/1  dlgvenvravATsAlReAkNgeeflerveeelgleievisgeeEarli----------------------


                         +         -         -         -         -         *         -:210
query           DESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLA
00495521   1/1  ggevlllvSlplGavrlterffkddpiskeeleaarkairelladllellr......tlvgvgGtirala
00498081   1/1  ggeivllvSlplGavrlterfflddliseeeleaakaaigealadllellrvlg.wdllvgvgGtirala
00498071   1/1  ----------------------------------------------------------------------
00495511   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RLTGAAPSSAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDK
00495521   1/1  rlllalngyplevihgyrltleeleelldkllslsleerlkklpglskdRadvivagalillallellgi
00498081   1/1  rlllal.....vlhgyrltleellellkrlleltleerlalpglsedRadvivaGaaillallellgiee
00498071   1/1  ----------------------------------------------------------------------
00495511   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VEICPWALREGVILTRIDKGLE------------------------------------------------
00495521   1/1  kelivsdgglreGlllelldrll-----------------------------------------------
00498081   1/1  lvvsdggLreGlllelldrllrl-----------------------------------------------
00498071   1/1  ----------------------------------------------------------------------
00495511   1/1  ----------------------------------------------------------------------