[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53610.1


[Show Plain Result]

## Summary of Sequence Search
   1::211
 112::192  2.3e-25 59.3% 0037617 00376171 1/1   omal protein S5 domain 2-like           
  43::111  5.6e-24 56.5% 0037618 00376181 1/1   -binding domain-like                    
  37::110  9.2e-23 52.7% 0042361 00423611 1/1   -binding domain-like                    
 111::181    5e-21 57.7% 0042360 00423601 1/1   omal protein S5 domain 2-like           
   1::211


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALV
00376171   1/1  ----------------------------------------------------------------------
00376181   1/1  ------------------------------------------dleekvlkikrvskvtkgGrrlrfsalv
00423611   1/1  ------------------------------------vdllledlkekvlkikrvskvtkgGrrlrfkalv
00423601   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
00376171   1/1  -----------------------------------------gtiphevlgkfgavkvllkpapeGtGiia
00376181   1/1  vvGdgnGlvGlGlgkakevalAirkaillAkknlilvplle-----------------------------
00423611   1/1  vvGdgnGlvGlGvgkakevaeAirkAillAkknlilvply------------------------------
00423601   1/1  ----------------------------------------dgtiphevlgkfgaakvlllpapeGtGiia


                         +         -         -         -         -         *         -:210
query           GGAARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQE
00376171   1/1  ggvvrkvlelaGikdvlakslGstnllnvvkAtfdaLlkllsletvallrgk------------------
00376181   1/1  ----------------------------------------------------------------------
00423611   1/1  ----------------------------------------------------------------------
00423601   1/1  ggvvrkvlelaGikdvlakslGstnllnvvkAtfdaLlklr-----------------------------


                         -         -         -         +         -         -         -:280
query           A---------------------------------------------------------------------
00376171   1/1  ----------------------------------------------------------------------
00376181   1/1  ----------------------------------------------------------------------
00423611   1/1  ----------------------------------------------------------------------
00423601   1/1  ----------------------------------------------------------------------