[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53649.1


[Show Plain Result]

## Summary of Sequence Search
   1::317
   1::313  3.2e-76 38.2% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
   1::307  6.9e-76 38.9% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   2::305  4.4e-73 36.9% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   1::308  4.5e-71 35.1% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   1::314  5.6e-70 36.6% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   1::313  1.5e-69 34.4% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   1::307  1.5e-68 34.4% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
   1::314  2.5e-68 33.3% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   1::312  4.9e-66 33.2% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   1::307  2.8e-65 35.2% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   1::307  3.3e-65 34.1% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   1::313  1.4e-64 34.2% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   1::312  3.6e-64 33.1% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   1::309  3.3e-63 33.4% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   1::316  6.3e-63 32.9% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   1::316  8.9e-61 33.0% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   1::313  1.1e-60 34.0% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   2::313  6.5e-60 33.7% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   1::312  2.4e-58 34.0% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
   1::310  3.3e-58 33.2% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   2::316  6.1e-57 33.3% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   1::310    2e-55 33.1% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   1::302  1.9e-50 36.5% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   1::316  2.1e-50 31.1% 0049198 00491981 1/1   )-binding Rossmann-fold domains         
   1::302  1.2e-45 35.2% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   1::247    3e-34 33.0% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   1::310  6.3e-34 25.7% 0048270 00482701 1/1   )-binding Rossmann-fold domains         
   1::305  8.7e-33 31.9% 0044853 00448531 1/1   )-binding Rossmann-fold domains         
   1::262  5.9e-27 21.2% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   1::262  4.6e-26 28.4% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   1::141  3.4e-24 30.4% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   1::240  3.7e-21 32.3% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   1::249  7.2e-20 19.5% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   1::248  7.4e-20 29.5% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::141  1.1e-19 29.0% 0045645 00456451 1/1   )-binding Rossmann-fold domains         
   1::154  6.1e-19 29.2% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   1::231  1.6e-18 20.5% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   1::248  9.7e-18 26.6% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   1::251    1e-17 19.0% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   1::182  5.9e-17 23.2% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   1::230  3.2e-15 19.0% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   1::153  9.8e-15 24.6% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::227  2.8e-13 19.5% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   1::129    3e-13 24.6% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   1::224  3.7e-13 20.2% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   1::142  3.5e-12 22.5% 0045621 00456211 1/1   )-binding Rossmann-fold domains         
   1::227  1.5e-11 21.4% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   2::231  2.8e-11 19.0% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   1::195  7.7e-11 22.0% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   1::224  8.2e-11 19.2% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   1::186  6.3e-10 22.6% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   1::123  1.1e-09 28.4% 0040868 00408681 1/1   )-binding Rossmann-fold domains         
   1::218  1.1e-09 19.5% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   2::231  1.1e-09 18.2% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   1::226  2.4e-09 20.3% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   1::227  2.4e-09 19.1% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   1::226  2.4e-09 19.7% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   1::117  2.7e-09 25.7% 0035405 00354051 1/1   )-binding Rossmann-fold domains         
   1::140  1.3e-08 21.5% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::231  1.5e-08 17.9% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   1::231  2.5e-08 18.4% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   1::168  3.6e-08 29.4% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   2::230  6.6e-08 19.5% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
   2::231  7.2e-08 18.0% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
   2::226  1.5e-07 20.9% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   1::175  1.9e-07 23.2% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::228  2.6e-07 17.1% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   1::127  3.4e-07 21.4% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
   2::206    4e-07 21.4% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   1::154  4.5e-07 25.2% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   1::31   4.9e-07 41.9% 0047550 00475501 1/1   )-binding Rossmann-fold domains         
   1::162  8.1e-07 22.1% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   1::219    1e-06 19.8% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   1::106  1.1e-06 26.5% 0052183 00521831 1/1   )-binding Rossmann-fold domains         
   1::162  1.5e-06 20.7% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   1::229  1.6e-06 19.1% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   2::215  2.3e-06 20.1% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   2::231  2.9e-06 17.9% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   1::232  4.2e-06 19.2% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   1::183  6.8e-06 20.6% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   1::227  7.5e-06 20.0% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   2::231  9.3e-06 18.1% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   2::74   1.5e-05 29.6% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   2::206  1.8e-05 22.7% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   1::106  2.6e-05 22.5% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
   2::74   4.5e-05 20.8% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   1::74   5.1e-05 21.4% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   2::226  5.2e-05 18.2% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   1::206  5.5e-05 21.9% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
   2::74   5.6e-05 23.3% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   1::164  7.4e-05 20.1% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   2::194  8.1e-05 19.5% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   2::224    9e-05 17.8% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
   1::137   0.0001 25.8% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
   1::74   0.00011 23.3% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   2::206  0.00011 22.5% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   2::74   0.00013 22.2% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   2::206  0.00015 22.0% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   1::74   0.00016 21.7% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   2::206  0.00019 21.8% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   2::74   0.00019 23.5% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   1::74   0.00021 21.9% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   2::206  0.00022 22.0% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
   2::74   0.00025 21.9% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
   2::74   0.00026 23.3% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   2::206  0.00028 22.0% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   2::30   0.00047 31.0% 0039935 00399351 1/1   )-binding Rossmann-fold domains         
   1::74    0.0005 20.5% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   1::74   0.00056 21.7% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
   1::74   0.00064 22.2% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   2::206  0.00068 21.4% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   2::74   0.00088 22.2% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   1::317


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
00519961   1/1  MkvLvtGatGfiGshlvrrLlerghleVvgldrls.sgleelle...lpgvefvegDltdpealeealak
00521161   1/1  MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerGyevvaldr.spekleelld....pgvefveg
00371281   1/1  -kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgakl.......gpgvefvegDltdpesleaalee
00419991   1/1  kkvLvTGgtGfiGshlaraLlerGaevvvldrlsegaeellaelealgprvefvkgDltdpealaallee
00383241   1/1  MgkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllslleklllllellgpr
00519251   1/1  kkkilvtGatGfiGsalaraLlergyevialdrspekleellkllvefvkgDltdpesleealkg..vdv
00462911   1/1  skkvLvTGatGfiGsalvrrLlerGyeVialdrlssgsneekleellkelellgpgvefvkgDltdpesl
00498641   1/1  krvLvTGgtGfiGsalaraLlerGaevvvldr.seekleelleeleallggrvefvegDltdpealeaal
00433371   1/1  ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefvegDltdpeslaaalag
00511831   1/1  llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldr.spekleelaallealggdpgvelvvg
00400431   1/1  MgkkvLvTGgtGfiGsalvraLlerGaevvvldr.dpegaaellallealggprvefvagDltdpealea
00490261   1/1  ktvlvTGatGgiGsalaraLlarGaeVvaldr.speklealaaeleallpllllfellglldellggrve
00468971   1/1  ktvlvTGatGgiGsalaraLlarpGaeVvaldrlsspeklealaallgalgvefvqgDltdpeslaaala
00464721   1/1  MgktvlvtGatGfiGsalaraLlarGaveVvaldrspe........Dltdpeslaaalagv.......rv
00465741   1/1  MgktvlvTGatGgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealgggvefvqgDltdp
00491171   1/1  ktvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealaellalggvefvqgDltdpesl
00460341   1/1  gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaaelgvefvqgDltdpeslaaal
00495191   1/1  -rktvlvTGatGgiGsalaraLlarGaeVvlldrlssglspekleellaellealgggvefvqgDltdpe
00482931   1/1  nktvlvTGatGgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggpgvefvqgDltdpes
00493571   1/1  llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldr.spekleelaaelealggslll
00514911   1/1  -SKtvlvTGatGgiGsalaraLlerGaeVvlldr.spekleellaeleallg.ggvefvqgDltdpesla
00507211   1/1  ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldr.spekleelaaelealggvefvqgDltdpe
00430421   1/1  MkgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevvegDltdpesla
00491981   1/1  lnpsemkgkrvlvtGgtGfiGsnlaelLlergyevvgldrsepglnslldllllaeniafvkgDlsdkea
00430411   1/1  MsgkkvlvtGAtGfiGshlaraLleaGhevvalvR.spekaalalalelleelaapgvevvegDltdpes
00516961   1/1  kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpsk.........llpgvevvvgDltdplaeala
00482701   1/1  MkilvtGanGqlGsalvrllaelg.dvvvla.............lgrdllllDltdpeavrellaelkpd
00448531   1/1  lmkilvtGaaGqlGsalvrllleaglevvald...............fvelDitdaeavaellaevkpdv
00354711   1/1  MslkgkvvlvTGasggiGralaralaaaGarVvlldr.seekleelaael.ggrvlavalDvtdeesvea
00532871   1/1  lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvr.spekleel.....gggvevvvgDltdpdslaa
00360071   1/1  lellllialenllllllllllellllsllkpmkVlVtGAaGfiGshlalrLlsgglagldqlvevvlldr
00471781   1/1  mmmmkvlvtGAtGfiGsalvrelleagheVtalvR.dpsklaall....glgvevvvgDltdpaslaaal
00486141   1/1  kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealae.......gggalavaaDvtdeeavealve
00527221   1/1  llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvR.rpekleelaae....gvevvvgD
00456451   1/1  mienlllllelllelellkslkkpmkvlvtGAaGfiGshlallLasgglagldqvvelvlldiveslgkl
00502281   1/1  mmkvlitGAtGfiGselvrlLlehgdhevtaldrrt.....sagkllnepgvevvegdlt.dpddlekal
00387701   1/1  mmdlkgkvalvTGasggiGlaiaralaaeGarVvlldr.neekleelaael.ggrvlavalDvtdeesve
00519911   1/1  lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvR.rpekleelaa....egvevvv
00385591   1/1  egkvvLVtGgsggiGraiaralaaaGarVvvvdrseeal.........gggvlavaaDvtdeeavaalva
00527441   1/1  amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleelaaelealggrvlfvaaD
00421311   1/1  kgkvalvTGassgiGraiAralaaeGarVvltdrnseekleelaaeleallggralavalDvtdealaee
00354771   1/1  MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsd..galavlldl
00514401   1/1  gsslldmldlkgkvalvTGasggiGraiAralaaaGarVvlld.rneekleelaaeleaelplllggrvl
00481861   1/1  kkvlvtGAsGgiGsalalllaarga.evvlldrspeklegvaldlsdlgvevvvadltdpeslaealkga
00436781   1/1  mdlkgkvalvTGassgiGlaiAralaaaGarVvlldr.seekleelaael.ggrvlavalDvtdeesvea
00456211   1/1  lkplkvlvtGAaGqiGsalalllalggladldlevelvlldivealdalkgvaldlsd..aalpllldvi
00468011   1/1  gkvalvTGassgiGraiaralaaaGarVvlldrneek.................vqlDvtdeesvealve
00398711   1/1  -mdlkgkvalvTGassgiGraiaralaaaGarVvlldr.neekleelaael.ggrvlavalDvtdeesve
00513551   1/1  lkgkvalvTGasggiGlaiaralaeeGdlakVvlldr.neekleelaael.ggrvlfvqlDvtdeesvea
00368061   1/1  dlkgkvalvTGassgiGlaiAralaaaGarVvlldr.neekleelaael.ggrvlavalDvtdeesveal
00511091   1/1  sslsllldmlslkgkvalvTGasggiGralaralaarGarVvlldr.seekleelaaelealgggrvlvv
00408681   1/1  mkvaivGatGmvGsvllelLleergfevvalvrlsssrsagkalvfkgv..ellvvdlldlealk.gvDv
00482861   1/1  mlkgkvvlvTGassGiGlalaralaarGasrVvlld.rneekleelaaelealggrvlfvqlDvtdeesv
00385451   1/1  -ldlkgkvalvTGasggiGlaiAralaaaGarVvlldr.seekleelaael.ggrvlavalDvtdeesve
00498451   1/1  gkvalvTGassgiGralaralaarGarVvlldrsee...........ggrvlavaaDvtdeesvealvaa
00503831   1/1  lllllllllllllldlllslldlkgkvalvTGasgGiGraiAralaaaGarVvlld.rneekleelaael
00528731   1/1  lkgkvalvTGassgiGlaiaralaaeGarVvlld.rneekleelaaeleallpggrvlavalDvtdeesv
00354051   1/1  lkpmkvlvtGAaGfiGyalalllaaggladldllvelvlldiveeyaleklkgvaldlsd..aaapllld
00387841   1/1  kkvlvtGAsGgiGsalalllakega.evvlvdrdeekalealagelldlgg.galvlvadvtdleavedl
00361941   1/1  mdlkgkvalvtGasggiGraiaralaaaGarVvlldr.neekleelaaelg..rvlavvlDvtdeesvea
00424291   1/1  mmlslkgkvvlvtGasggiGralaralaaaGarVvlldr.seekleelaaelg..rvlavvlDvtdeesv
00530191   1/1  kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasagkgvevvlgdltdldlla....aalagvd
00509671   1/1  -dlkgkvalvTGassgiGlaiAralaaeGarVvltd.rneekleelaaelealglpsgrvlavalDvtde
00380681   1/1  -gkvalvTGasggiGlaiaralaaeGarVvlldr.neekleelaaelealggrvlavalDvtdeesvaal
00383421   1/1  -pslslkgkvalvTGasgGiGralaralaarGa.rVvlldrsglssllllsaekleelaael.ggrvlav
00367851   1/1  kgkkvlviGa.GgiGralaraLaeaGaevt.vadrslekaealaael..ggveavelDvtdeasldaalg
00515681   1/1  mdlkgkvalvTGassgiGlaiAralaaaGarVvltd.rneekleelaaelealggrvlavalDvtdeesv
00465291   1/1  PctplgvllllellgillllllmmlrlkgkvalVtGassgiGralAllLareGatVvvvd.rneekleel
00409101   1/1  -mmdlkgkvalvTGassgIGlaiaralaaeGarvvlldr.neekleelaaelealpg.grvlavalDvtd
00496861   1/1  AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaid.rseekleklkelga
00475501   1/1  MkiaiiGGtGniGsalAlrLaaaGheVvvvs---------------------------------------
00512031   1/1  dslsllslkgkvalvTGassGiGraiAralaeeGarVvltd.rneekleelaaelealgggkvlavalDv
00512601   1/1  sdmslkgkvalvTGasggiGlalAralaarGarVvlld.rseekleelaaelealggrvlvvalDvtdee
00521831   1/1  mKilviGaaGyvGsslalllakkgllgdelvlvDieekleglaldlsdiae..fllldlvittdlyealk
00519651   1/1  smdlkgkvalvTGassgiGlaiAralaaaGarVvltd.rneekleelaaeleaggrvlavqlDvtdeesv
00517631   1/1  mldlkgkvalvtGassgiGlaiaralaaaGarVvlld.rneekleelaae...grvlavalDvtdeesve
00512791   1/1  -lldlkgkvalvTGassgiGlaiAralaaaGarVvlldr.neekleelaaelg..rvlavalDvtdeesv
00509551   1/1  -lllmlldlkgkvalvTGassgiGlaiAralaaaGarVvlldr.neekleelaaeleallpggrvlaval
00510061   1/1  mslkgkvalvTGassgiGlaiAralaaeGarVvltd.rneekleelaaelealglpsgrvlavalDvtde
00506551   1/1  sGmkvalvTGassgiGlaiaralaealGakVvltd.rneekleelaaelealggrvlfvalDvtdeesve
00507761   1/1  mlkgkvalvTGassgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlavalDvtdeesv
00413661   1/1  -mmdlkgkvalvtGassgiGlaiaralaaeGarVvlldr.neekleelaael.ggrvlavalDvtdeesv
00485161   1/1  -lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavd.rseek
00517021   1/1  -ldlkgkvalvtGassgiGlaiAralaaaGarVvlldr.seekleelaael.ggrvlavalDvtdeesve
00472761   1/1  ysrplllgligllgakvlpgkkvaviGa.GgvGlalAlalaaagaagevtlvDide.ekleglardlldi
00503651   1/1  -slkgkvalvtGassgiGlaiAralaeeGakVvltd.rneekleelaaelealggkvlavalDvtdeesv
00532861   1/1  sdmldlkgkvalvtGassgiGlaiAralaeeGakVvltd.rneekleelaaelealggkvlavalDvtde
00450761   1/1  -llvlllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseekleelaaelealgg.rv
00520851   1/1  llsllsllkgkvalvtGassgiGlaiAralaaaGarVvltd.rsaekleelaaelealggrvlavalDvt
00482431   1/1  -lpvalvTGassGiGlaiAralaaaGarVvltdrlneekleelaaelralpggrvlavalDvtdeesvle
00421801   1/1  DgigavsllkrllvdlpgkkvlvlGa.GgiGralalalaaagaevvvvnr.tlekaeelaeelga...qg
00388141   1/1  -ldlkgkvalvTGassgiGraiaralaarGarVvlldr.seekleelaael.ggrvlavalDvtdeesva
00394381   1/1  -mmslkgkvalvTGassgiGraiaralaaaGarVvltdrsgeekleelaaelealggrvlavalDvtdee
00422071   1/1  mkVgivGAtGrvGrllvrlllahpgvevvavvsra..eaaellkllg....................adv
00502371   1/1  mdlkgkvalvtGassgiGlaiAralaaaGarVvltd.rnaekleelaaellealggrvlavalDvtdees
00499421   1/1  -ldlkgkvalvtGassgiGlaiaralaaaGarVvlldr.seekleelaael...rvlavalDvtdeesve
00476811   1/1  -kgkvalvTGassGiGlaiAralaaaGarlllVvltdr.neekleelaaelrallpsggrvlavalDvtd
00350181   1/1  -mmdlkgkvalvTGassgiGlaiaralaaaGarVvlldr.neekleelaaelralggrvlavalDvtdee
00523681   1/1  dllkgkvalvtGassgiGlaiaralaeeGakVvltd.rnee.leelaeel...kvlavalDvtdeesvea
00471241   1/1  -llmllslkgkvalvTGassGiGlaiAralaaaGarVvltdr.seekleelaaeleallg.grvlavalD
00480351   1/1  -gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladr.neeklealaaelg
00474701   1/1  dlkgkvalvtGassgiGlaiAralaaeGarVvltd.rneekleelaaelealggkarvlavalDvtdees
00451531   1/1  -psllslkgkvalvTGassgiGlaiAralaaaGarVvltdr.neekleelaaelealggrvlavalDvtd
00519551   1/1  -kkvalvtGassgiGlaiAralaeeGarlllleeeVvltdrneekleelaaelealggkvlavalDvtde
00464831   1/1  -sgkvalvTGassGiGlaiAralaaeGakVvlltdrneekleelaeeleallggkvlavalDvtdllell
00380421   1/1  -mmlslkgkvalvTGassGiGlaiaralaaaGarVvlldr.neekleelaaeleallg.grvlavalDvt
00399351   1/1  -kskktilVtGATGylGrsvvraLlergyp----------------------------------------
00525291   1/1  gdlsgkvalvtGassgiGlaiAralaaeGarVvltdrneleelaaelealg.grvlavalDvtdeesvea
00425051   1/1  kvalvTGassgiGraiAlalaaeGarVvltdr.neealeela....ggkalavalDvtdeesvealveaa
00532661   1/1  gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdr.neekleela.ellalggkvlavalDvtdee
00353051   1/1  -mdlkgkvalvTGassGIGlaiAralaarGarvvlldr.neekleelaaelralpggrvlavalDvtdel
00376621   1/1  -llllmllslkgkvalvTGassgiGraiAralaaaGarVvltdr.neekleelaaelealggrvlavalD


                         -         -         *         -         -         -         -:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
00519961   1/1  gvdaVihlAalvsvdeseedplefievnvlgtlnlleaarkagkrfvfaSsaavygdpeglpidEddwld
00521161   1/1  DltdpealeealegvdaVihlAalssvgeseedppleflevNvlgtlnlleaarkagvkrfvfaSSsavy
00371281   1/1  vekfggvdvvihlAaissvdes..dpeelldvNvlgtlnlleaarkagvrfvytSSaavyggppglpidE
00419991   1/1  igvdaVihlAaissvdlseedpeevldvNvlgtlnlleaarkagvkprfvfiSSaavyggspgqpldesl
00383241   1/1  vefvegDltdpealaaalaefggvdvVihlAalvhvdlseedpeevldvNvlgtlnlleaarkagvkrfv
00519251   1/1  vihlAaivgvdlseedpeetidvNvlgtlnlleaarkagvrfvfiSSsavygdpkkgpidEddllllnpl
00462911   1/1  eealkgvkpdvvihlAaivhvdlseedpeetidvNvlgtlnlleaarkagvksggrfvfiSSsavyggpp
00498641   1/1  eevgvdvvihlAgissvdlseedpeevldvNvlgtlnlleaarkagvgrivfiSSaavyggseegpidEd
00433371   1/1  vrpdvvvhlAalssvdlseedpeevldvNvlgtlnlleaareagvvgrivfvSSaavyggppglpidEdt
00511831   1/1  DltdpesleaalegvdvvihlAgiasvg...edpeelidvNvlgtlnlleaarkagsvkrivfvSSiaav
00400431   1/1  ala...gvdaVvhlAalshvdlseedpeevlevNvlgtlnlleaarkagvrfvfiSSaavyggsplllll
00490261   1/1  fvegDltdpesleaaleevgvDvvvhnAgissvgpseltledpeevldvNvlgtlnlleaalpagvggri
00468971   1/1  gvridvvihnAgivlvdlseedpeevldvNvlgtlnlleaalpagvkrggggglslrivfvSSiavyggp
00464721   1/1  dvvihlAgivsavdlseedpeevldvNvlgtlnlleaarkagvkrivfvSSiavyggpgglpidEddlll
00465741   1/1  eslaaaleevgvdvvihnAgiplvdlseedpeevldvNvlgtlnlleaalpagvgrivfvSSiavygdpd
00491171   1/1  aaalagvdvvvhnAgivsvdlseedpeevldvNvlgtlnlleaarkagvgrivfvSSigvyggpgglpid
00460341   1/1  agvriDvvihnAgivsvdlseedpeevldvNvlgtlnlleaalpagvkrggggglslrivfiSsiavygg
00495191   1/1  slaaalagvrldvvvhnAgivgvdlseedpeevldvNvlgtlnlleaalpagvksggrivniSSiavygd
00482931   1/1  laaalagvrldvvvhnAgissvdlseedpeevldvNvlgtlnlleaalpagvkrggggrivniSSigvyg
00493571   1/1  ggvefvqgDltdpesleaalagvdvvvhnAgivgvdlseedpeevldvNvlgtlnlleaalpagvgrivn
00514911   1/1  aaleevgvdvvvhnAgivgvdlseedpeevldvNvlgtlnlleaalpagvgrivfvSSiavyggllllpp
00507211   1/1  slaaalagvriDvvvhnAgiplvdlseedpeevldvNvlgtlnlleaarkagtvgrivnvSSagvygdpg
00430421   1/1  ealkgvDvVihlagl...........evidvnvlgtlnlleaakeagnvkrfvfvSsagvygd.......
00491981   1/1  lkraladvkpdvVihlAavsgprvsaadpeavydtnvlgtlnlleaakkagpvkrlvfvStagvygdvsa
00430411   1/1  laealkgvdvVihlag...............dvnvlgtlnlleaakkagvkrfvfvSsagvygd......
00516961   1/1  gvdvvihlagv..vrfsagdpeaflavnvdgtlnlleaaraagvkrfvlvSslgaygd............
00482701   1/1  vvinaaAytavdkaesdpelayavNvlgplnLaeaaaelgarlvhiSTdyVFdgtkglpyted.....dp
00448531   1/1  vinaAAytavdraesepelalavNvlgtavlaeaarelgarlvhiSTDyVFdglkegp.....yteddpl
00354711   1/1  aveavleefggldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrkaggriv
00532871   1/1  ala...gvdavvhlagivgvgalllllllksllelseedpeevldvnvlgtlnlleaakaagvkrivlvS
00360071   1/1  leslekleglaldlsda.atfllgdvsdtadleealkgadvvvhlAgvprkpgm..drldllkvnvkgtk
00471781   1/1  a...gvdaVihlag.......padpldllevnvdgtrnlleaakaagvkrlvlvssagaygdepgppl..
00486141   1/1  aaveafggldvlvnnagillplgplldlsledwdrvldvnllgtflllraalpllvkggrivnisSvagy
00527221   1/1  ltdpeslaealkgvdvvinaagttrfg...edleeflavnvdgtlnlaeaakkagvkrfvlvSslgalgp
00456451   1/1  egvaldlsdaaf.pllgdvtvgtdlyeafkgadvvvhlAgvprkpgm..drldllktnvkitknlleaaa
00502281   1/1  k.gvDvvihaagtsrvdeslkdalgtnvigtssalrllnlleaakeagvkrfvhvstagvygllegvpel
00387701   1/1  alveavleefgrldilvnnAgialpgplldlsledfervldvnllgtflltraalplmrkrggrivnisS
00519911   1/1  gDltdpeslaaalk...gvdvvinaagitrvg...edleefldvnvdgtlnlldaakkagvkrfvlvSsl
00385591   1/1  aavellefggldvlvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvkggrivnissva
00527441   1/1  vtdpesvealvaeileefgldvlvnnAgillvgpledlsledfervldvnvlgtfnllraalplgvgriv
00421311   1/1  leelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplldlsledwdrvl
00354771   1/1  tdtddlaealkgadvvvhlagv..prkpgedrddllavnvlgtralleaarkagvgrivvvssgnpvdil
00514401   1/1  avalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNvlgtflltraalpl
00481861   1/1  dvvviaagip..rkpgedrldlldvnvlgvknlleaaakagvgrivlvssnpvdglaya-----------
00436781   1/1  lvaaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaes
00456211   1/1  dtddlyealkgadvvvhtAgvprkp..gmtrldllevNvkitknlleaiakygpkavvvlvvsnpvdilt
00468011   1/1  avleefggrldilvnnAGialpgpll...ervldvNllgtflltraalpllrkrgggrivnisSlavyga
00398711   1/1  alvaavleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrglggrivni
00513551   1/1  lveeileefgrlgldilvnnAgillplgplldlsledfervldvNllgtflltkaalplmkkrgalssge
00368061   1/1  veaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaesg
00511091   1/1  aaDvtdeesvealveeileefgrldilvnnAgillpdgpled.sledfervldvNvlgtflltraalplr
00408681   1/1  vifaagg..................dvtlklapalaeagvkrvvidsssalrm-----------------
00482861   1/1  ealveevleefgrldilvnnAGil.gpledlsledfllervldvNvlgtflltraalplllkggrivnvs
00385451   1/1  alvaealeefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnis
00498451   1/1  alefgrldilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkrgaasgggggri
00503831   1/1  eallggrvlavalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNllgtf
00528731   1/1  ealveevleefgrldilvnnaGil....sledfervldvnllgtflltraalpllrkrglggggrivnis
00354051   1/1  ltvttdlyealkgadvvvilAgvprkpg..mtrldllevnakifkel-----------------------
00387841   1/1  vealggadvvvnnagvp..rkpgeerldllevnvlgtknlaealkkagpg.rivvvsspagllglpalkv
00361941   1/1  aveelggldvlvnnagialpgplldlsledfervldvnllgtflltraalplmrkrglggrivnissvag
00424291   1/1  eaaveelggldvlvnnagiallgplldlsledfervldvnllgtflltraalplmrkaglggrivnissv
00530191   1/1  vvflaaga..................gatlalaeaaaaagvkvidlssafradd................
00509671   1/1  esvealveevleefgrldilvnnAgialpgpgllldlsledfervldvnllgtflltraalplmlkrggr
00380681   1/1  veavleefgrldilvnnagillvgplldlsledfervldvnllgtflltraalplmrkrglggrivnisS
00383421   1/1  alDvtdeesvealveaaleefgrldilvnnAgilldgplleltledwervldvnllgtflltraalplmr
00367851   1/1  daDvvinaapvglhaeiveaaleagkhvvdenplaaetralleaakeagvgrivnvssaagy........
00515681   1/1  ealveavleefgrldilvnnaGillplgplldlsledfervldvnllgtflltraalplmrkrgggrivn
00465291   1/1  aeeieaaggkavvldvsdeedlkelvgrlDilvnnagipllkplldltkegwdvidv-------------
00409101   1/1  elesvealveealeefgridilvnnAGi....lsledwervldvNllgtflltraalplmrkrglglggr
00496861   1/1  dvvldvt..dveellkallklggvdvvihtagapvtelslsllkqllrvnvlgtlnllrallpllvklgv
00475501   1/1  ----------------------------------------------------------------------
00512031   1/1  tdeesvealveeileefgrldilvlnnAGillpgpled.sledwervldvNllgtflltkaalplmkrgg
00512601   1/1  svealveevleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrgggriv
00521831   1/1  dadiviitag..vprkpgmsrldlleinakivkdia----------------------------------
00519651   1/1  ealveevleefgrldilvnnAgilgpllgplldlsledfervldvnllgtflltraalplmrkrgggriv
00517631   1/1  alveefgrldilvnnagillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisSvag
00512791   1/1  ealveavleefgrldilvnnagillvlgplldlsledwervldvnllgtflltraalplmrkrggrivni
00509551   1/1  DvtdeesvaalvaavleefgrldilvnnAgillpgpllelsledwervldvnllgtflltraalplmrkr
00510061   1/1  esvealveavleefgrldilvnnaGialpgplegslldlsledfervldvnllgtflltraalplmlkrg
00506551   1/1  alveeileefgrldilvnnAGil.vgpledlsleldfervldvNllgtflltkallplmkksgrivnisS
00507761   1/1  ealveevleefgrldilvnnagialpgplldlsledfervldvnllgtflltraalplmrkrgggrivni
00413661   1/1  ealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggrivni
00485161   1/1  lell------------------------------------------------------------------
00517021   1/1  alvaavleefgrldilvnnagilllgplldlsledwdrvldvnllgtflltraalplmlkrgrivnisSv
00472761   1/1  lellgvglvvttdleealkgaDvviiatg..vprkp----------------------------------
00503651   1/1  ealv------------------------------------------------------------------
00532861   1/1  esve------------------------------------------------------------------
00450761   1/1  lavalDvtdeesvealveavleefgrldilvnnAgillpgpleelsledfervldvnllgtflltraalp
00520851   1/1  deesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrggg
00482431   1/1  llea------------------------------------------------------------------
00421801   1/1  dvsdleeleealggaDivvnatgaglpglllelllellkpggvvvdvayppllttallplararglgriv
00388141   1/1  alvaavleefgrldilvnnagvlldgplldltledfervldvnllgtflltraalpllrkrgggrivnis
00394381   1/1  svealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmlkrgrivni
00422071   1/1  vv..................datppdvlaelaeallkagvdaVilsaGfrlsdlllvellydaaggv---
00502371   1/1  veal------------------------------------------------------------------
00499421   1/1  alvaavleefgrldilvnnagilldgplldltledfdrvldvnllgtflltraalplmrkrgggrivnis
00476811   1/1  eesv------------------------------------------------------------------
00350181   1/1  svealveavleefggrldilvnnagillpgplldltledfervldvnllgtflltraalpllrkrgggri
00523681   1/1  lvee------------------------------------------------------------------
00471241   1/1  vtdeesvealveavleefgrldilvnnAgillpgplleltledfervldvnllgvflltraalplmrkrg
00480351   1/1  alg.------------------------------------------------------------------
00474701   1/1  veal------------------------------------------------------------------
00451531   1/1  eesvealveaileefggrldilvnnagillpgplldltledfervldvnllgvflltraalplmrkrggg
00519551   1/1  esve------------------------------------------------------------------
00464831   1/1  elel------------------------------------------------------------------
00380421   1/1  deesvealveaaleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmrkrglg
00399351   1/1  ----------------------------------------------------------------------
00525291   1/1  lvea------------------------------------------------------------------
00425051   1/1  veef------------------------------------------------------------------
00532661   1/1  svea------------------------------------------------------------------
00353051   1/1  esvealveevleefgrldilvnnAGi....lsledwervldvNllgvflltraalplmrkrglglggriv
00376621   1/1  vtde------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
00519961   1/1  veltplnplspYgasKlaaelllrayareygldvvilrpfnvyGpglspllgeshvlggliplfiraalg
00521161   1/1  gdpeglpidEdtlldvdleplnplspYgasKlaaellarayareygldvvilrpfnvyGpgdrpngvtgs
00371281   1/1  dtpln.....plspYgasKaaaellvralareyglrvvilrpgnvygpggrpdgltssviplllrlalag
00419991   1/1  lldvdllpllaitEdtplnplspYaasKaaaealarayareyglrvvilrpgnvyGpggrpglpsgvlpl
00383241   1/1  faSSaavyggnplllllddelpidEdd.....plnplspYgasKaaaeklvrayareyglpvvilrpgnv
00519251   1/1  nplspYgasKlaaekllrayakeyglrvtilrpgnvyGpgqrpnggsviplfirlilkgkpltifgdgdq
00462911   1/1  glpidEd.....dplnplspYgasKaaaelllrayakeyglrvvilrpgnvyGpgggpdgvtskviplli
00498641   1/1  dpld....pplspYgasKaaaellaralarelygirvvilrpgnvygpglrpllgedplgalggllplll
00433371   1/1  pln.....plspYgasKaaaellaralareyglrvvilrpgnvygpggrpdgvtsnliplllrlalggep
00511831   1/1  ygdplllpglpidEdtwldvdllaalllllelplpplspYgasKaaaealaralarelapglrvvilrpg
00400431   1/1  lglllldglpidEdtpld.....plspYgasKaaaellvrayareyglrvvilrpgnvyGpggrpe..sl
00490261   1/1  vfvSSiavygdpd.gpidEddlllvllllllllltplpplsaYgasKaaaelllralarelgirvtilrp
00468971   1/1  ggllevllesllgpldedd.....plnplspYgasKaaaeallralarelgirvtilrpgnvygpggrp.
00464721   1/1  lplnplsapYgasKaaaelllralarelglrvtilrpgnvygpggrpllglsgvlprlirlallaalagl
00465741   1/1  glpidEgdpgl....pplspYgasKaaaelllralaregsgirvtilrpgnvygpglspllgelllgvpd
00491171   1/1  Edtp.....lpplspYgasKaaaeallralarelglrvtilrpgnvygpgggp..gnllplllraalagl
00460341   1/1  lpgqsgpitEdd.....pldplspYgasKaaaeallralarelgirvtilrpgnvygpgggp..gnllpl
00495191   1/1  peglpidEd.....tplpplspYgasKaaaeallralarelgirvtilrpgnvygpggrpllvtsllplf
00482931   1/1  dpgg.pidEddpl.....nplsaYgasKaaaeallralarelgirvtilrpgnvygpggrpglvtsllpl
00493571   1/1  iSSigvyggpggapidEdd.....plnplspYgasKaaaeallralarelgirvtivrpgnvygpglrpl
00514911   1/1  glpidEddp..lnpl...spYgasKaaaelllralareapygirvtilrpgnvygpllsgllgelllgvp
00507211   1/1  lggpidEddpldp.....lspYgasKaaaeallralarelaptglllelgirvtivrpgnvygp.glgfp
00430421   1/1  edtpln.....plspygasKaaaekllra....sglpvtilrpgnvygpglsg....liplllklalkgg
00491981   1/1  gipidEdd.....pllptspyglsKlaaEqilrslarryldkplnrqhglpvvvlrpgnvyGpgdql.ls
00430411   1/1  .edtplp.....plspygasKaaaeallral....glpvtivrpgnvygpglsg.....iplllrlalkg
00516961   1/1  ......plspyarsKaaaeallral....glprvtilrpglvygprdgfllallll...........lll
00482701   1/1  pnPlnvYGrsKlagEqavlaa....gpkalilRtswvyg....elgknfvktmlrlaaerdelsvvgd..
00448531   1/1  aPlsvYGasKlagellv....lallptylilRtswvygpggnf.....vklmlrlalegkelpvvgd..q
00354711   1/1  nisSvaglg................glpglaaYaasKaalegltrslarelapgirvnavapglvdtpll
00532871   1/1  slgaygg......dedtp.....lpplspygasKaaaeallra....sglrvtilrpglvlgpllsg...
00360071   1/1  n---------------------------------------------------------------------
00471781   1/1  ..........plspyaaskaaaeellra....sgldytilrpgalfgpg.................rtgv
00486141   1/1  g................plpglaaYaasKaavegltrslalelapllkgirvnavapglvdtpllra...
00527221   1/1  spsp..................yaasKaaaeallral....glprvtivrpglvlgplgeplpge.....
00456451   1/1  k---------------------------------------------------------------------
00502281   1/1  ledallilnp...n--------------------------------------------------------
00387701   1/1  vagll................glpglaaYaasKaalegltralalelaprglgirvnavapglvatpllr
00519911   1/1  galg..................pspspyaasKaaaeallral....gldlvtivrpglvlgplls.....
00385591   1/1  glg................glpglaaYgasKaavegltrslalelapllkgirvnavapgnvdtpmlrg.
00527441   1/1  niSSiagvlgsp.................gqsaYaasKaale----------------------------
00421311   1/1  dvnllgtflltraalplmrkrsaessggggrivnisSvagll................glpglaaYaasK
00354771   1/1  alvale.......---------------------------------------------------------
00514401   1/1  lrkrgggrivniSvagllg.................lpgqaaYaasKaalegltrslalelaprgirvna
00481861   1/1  ----------------------------------------------------------------------
00436781   1/1  glgggrivnisSvagllglp.................glaaYaasKaalegltrslarelaprgirvnav
00456211   1/1  yi--------------------------------------------------------------------
00468011   1/1  lldlpllelllllllldlledvaglrglplglaaYaasKaalegltrslalelaprgirvnavaPglvdT
00398711   1/1  sSvagll................glpglaaYaasKaalealtrslalelaprgirvnavapglvatplla
00513551   1/1  llslgggrivnisSiagllglpglgllel.........plaaYaasKaalegltr---------------
00368061   1/1  ggggrivnisSvagllglp.................glaaYaasKaalegltrslalelaprgirvnava
00511091   1/1  krglgrivnisSiagllglpg................qaaYaasKa------------------------
00408681   1/1  ----------------------------------------------------------------------
00482861   1/1  SvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaaYaasKaalegltrsla
00385451   1/1  Svagllglp.................glaaYaasKaalealtrslalelaprgirvnavapglvatplla
00498451   1/1  vnisSvagl................lglpglaaYaasKaalegltrslalelaprgirvnavapglvdtp
00503831   1/1  lltraalplllkrglggrivnisSvagllglp.................gqaaYaasKaalegltrslal
00528731   1/1  Svagll................glpglaaYaasKaalegltrslalllela.ptgirvnavapglvrtpl
00354051   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00361941   1/1  ll................glpglaaYaasKaalegltrslalelaprgirvnavapglvatpllralll.
00424291   1/1  agll................glpglaaYaasKaalegltrslalelaprgirvnavapglvltpllrall
00530191   1/1  ....vpyglpkvnaealllasglniiar------------------------------------------
00509671   1/1  ivnisSlvagllglp.................glaaYaasKaalegltrslalela.prgirvnavapgl
00380681   1/1  vagll................glpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllral
00383421   1/1  krglgrivnisSvagllglpgqaa.................YaasKaalegltrslalelaprgirvnav
00367851   1/1  ........adgrglpayqaakaalealllglalel-----------------------------------
00515681   1/1  isSvagll................glpglaaYaasKaalegltrslalelaprgirvnavapglvdTpll
00465291   1/1  ----------------------------------------------------------------------
00409101   1/1  ivnisSvagll................glpglaaYaasKaalegltrslalela.ptgirvnavap----
00496861   1/1  krivyissvgvv..--------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00512031   1/1  grivnisSiagllglpg.....------------------------------------------------
00512601   1/1  nisSvagll................glpglaaYaasKaalegltrslalelaplgltgirvnavapglvd
00521831   1/1  ----------------------------------------------------------------------
00519651   1/1  nisSvagllglpgl........------------------------------------------------
00517631   1/1  lllglp.................glaaYaasKaalegltrslalela.prgirvnavapglvdtpllrgl
00512791   1/1  sSvagl................lglpglaaYaasKaalegltrslalela.prgirvnavapglvdTpll
00509551   1/1  gldggrivnisSvagllglp...............llglaaYaasKaalegltrslalelllaprgirvn
00510061   1/1  grivnisSlvagllglpgla................aYaasKaalegltrslalela.prgirvnavapg
00506551   1/1  iagllglpdlglllleelllddlllldllellslllellleal---------------------------
00507761   1/1  sSvagll................glpglaaYaasKaalegltrslalela.prgirvnavapglvdTpll
00413661   1/1  sSvagllglp.................glaaYaasKaalegltrslalelaprgirvnavapglvdtpll
00485161   1/1  ----------------------------------------------------------------------
00517021   1/1  aglglp.................glaaYaasKaalegltrslalela.prgirvnavapglvdtpl----
00472761   1/1  ----------------------------------------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00532861   1/1  ----------------------------------------------------------------------
00450761   1/1  lmlkrgrivnisSvagll...............lglpglaaYaasKaalealtrslalelaprgirvnav
00520851   1/1  rivnisSvagllglpgl.................aaYaasKaalegltrslalela.prgirvnav----
00482431   1/1  ----------------------------------------------------------------------
00421801   1/1  dglsmlvlqgapg...........----------------------------------------------
00388141   1/1  Svagllglp.................gqaaYaasKaalealtrslalelaprgi----------------
00394381   1/1  sSvagll...............lglpglaaYaasKaalealtrslalelaprgirvnavapglvdTplla
00422071   1/1  ----------------------------------------------------------------------
00502371   1/1  ----------------------------------------------------------------------
00499421   1/1  Svagl.glp.................gqaaYaasKaalegltrslalela.prgirvnavapglvd----
00476811   1/1  ----------------------------------------------------------------------
00350181   1/1  vnisSvagllglp.................glaaYaasKaalealtrslalela.prgirvnavap----
00523681   1/1  ----------------------------------------------------------------------
00471241   1/1  lggrivnisSvagllallllll.........glpglaaYaasKaallgltrslalel.aprgirvn----
00480351   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00451531   1/1  rivnisSvagllglp.................glaaYaasKaalealtrslalela.prgirvnav----
00519551   1/1  ----------------------------------------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00380421   1/1  grivnisSvagll................glpglaaYaasKaalegltrslalela.prgirvnav----
00399351   1/1  ----------------------------------------------------------------------
00525291   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00532661   1/1  ----------------------------------------------------------------------
00353051   1/1  nisSvagll................glpglaaYaasKaalegltrslalelaptgirvnavaPglv----
00376621   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
00519961   1/1  gkpltvfgdgdqvrdfihvdDvaealllalekpeslaaggvynlgggenpvsvrelaellakalgkkipi
00521161   1/1  viplliraalgkgepltvfgdgdqvrdfihvdDvaealllaleapaggvynigggepvsvrelaellael
00371281   1/1  epltlvlgdgdqlrdfihvdDvadaillaledpaggiynvgggepvsvlelaealaellgrplplvpipf
00419991   1/1  lirqilraalglggpltvfgdgdqvrdfihvdDvaeaillaleklagavggvynigggleepvsvlelae
00383241   1/1  yGpggspllgeshvlptlllplilqvalggatasviprflraalaggplpvfgddygtpdgdqtrdfvhv
00519251   1/1  trdfihvdDvaeaillalekpksgiynigsgepvsilelaeliakllglkikivfvplrpgdvlrllldi
00462911   1/1  raalkgkplpilgdgdqtrdfihvdDvaeaillalekpageiynigggepvsvrelaeliakllgkkiki
00498641   1/1  raalgkgepltvlgldyptgdgdqvrdfihvdDvaeavlllledlasgatggvynvgggepvsvrelaea
00433371   1/1  ltvlgdgdqvrdfvhvdDvaeavlllleapaggvynlgggeevsvlelaealaellglpvpivvvptpll
00511831   1/1  nvygpglrptlvtsliplfiaailaglpl.rlgdgdqtrdfvhvddvaeavllaledpaagevynlggge
00400431   1/1  iplllraalkggpltvfgdgdqvrdfvhvdDvadaillalekpaaggvynlgggepvsvrelaealaell
00490261   1/1  gnvygpglrplgligellllldpsgvvggllprllraalageplpvlgdgdqvrdfihvdDvaraillll
00468971   1/1  .gnllplllraalagkplpvlgdgdqvrdfihvddvarailllledpaagevynlgggepvsvrelaeal
00464721   1/1  pvltvlgdgdqvrdfihvddvaraillaleapaaglddlllvlggvynlgggepvsvrelaealaealgl
00465741   1/1  sllplflraalgglgplpvlgslydtlDgdqvrdfihvddvaraillalenpaaggegrvynlgggepvs
00491171   1/1  pltvlgdgdqvrdfihvddvaravlllledpaaggvynlgggepvsvrelaealaealglplplvefppl
00460341   1/1  llraalaglplpvlgdgdqvrdfihvddvaravlllledpaagevynlgggepvsvrelaealaealglp
00495191   1/1  lrlalaggplplvlgdgdqvrdfihvddvaravlllledpaageynlgggepvsvrelaealaellglpv
00482931   1/1  flrlalaglpltlvlgdgdqvrdfihvddvaravlllledpaggvynlgggepvsvrelaealaellglp
00493571   1/1  gvtgsllplllraalaggplpvlgdgeqvrdfihvddvaravlllledlpgaigevynlgggepvsvrel
00514911   1/1  gsliplllraalgggeplpvfgslyltlDgdqvrdfihvddvaraillalenpaaggglllllgvynlgg
00507211   1/1  gnllplllraalaglplpv.gdgdqvrdfihvddvarailllledllaspgatgevynlgggepnlvsvr
00430421   1/1  pllilgdgdqkrdfihvdDvaravvlaledpeatgeiynlggsgeplslrelaellakvlgrplpvvpvp
00491981   1/1  rliprlvkaalegkplpiagdg.arrdlvhvdDvadalvlaaenlrkgppargqiynigngepnvvslle
00430411   1/1  gpllilgdgdakrdfvhveDvaravvlaledpeatgkvynlgggseavsvrelaellakalgkkvpvvpv
00516961   1/1  lgdgdqrrspihvddvaralvaalldpaaagkvynlg---------------------------------
00482701   1/1  qigsptytldlAdailallllllaggelsgiyhlsgggavswyefalailelaevlgldlklllvlpipt
00448531   1/1  igdptyvedlAraillllekgllGiyhlsgggelswyefalailellgldvevlpisteeyptpadrPan
00354711   1/1  r...glllpllllalllgellevlgdgiplgrlgtpedvadavlflasdpea------------------
00532871   1/1  ..........lrlggllllgdgdalrsfisvedvadavvlaledpaatgevf------------------
00360071   1/1  ----------------------------------------------------------------------
00471781   1/1  llllgdgdglrslisvddvAaalvlaledp----------------------------------------
00486141   1/1  ..................lgdgtplgrlgtpedvaeavl-------------------------------
00527221   1/1  ...lllaggllllgdgdakrspisvddvaralvaaled--------------------------------
00456451   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00387701   1/1  g........llllalleella-------------------------------------------------
00519911   1/1  ...pllgealllpgllllgdgdakrrpisvedvaravv--------------------------------
00385591   1/1  ....................lldgtplrrlgtpedvaeavl-----------------------------
00527441   1/1  ----------------------------------------------------------------------
00421311   1/1  aalegltrslalelaprgir--------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00514401   1/1  vaPglvdTpllaalll.-----------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00436781   1/1  apglvatpllagll--------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00468011   1/1  pllrgllal........-----------------------------------------------------
00398711   1/1  gllllll..llllllleelle-------------------------------------------------
00513551   1/1  ----------------------------------------------------------------------
00368061   1/1  pglvdtpllagllg--------------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00408681   1/1  ----------------------------------------------------------------------
00482861   1/1  rellllla--------------------------------------------------------------
00385451   1/1  gl.............lpelle-------------------------------------------------
00498451   1/1  llagllp.........------------------------------------------------------
00503831   1/1  elaprgirvnavapglv-----------------------------------------------------
00528731   1/1  lagllpll.lllllee------------------------------------------------------
00354051   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00361941   1/1  ..........leelleallal-------------------------------------------------
00424291   1/1  l...........leellaall-------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00509671   1/1  vdTpllrgllalllllllll--------------------------------------------------
00380681   1/1  lal..llllllllleevleal-------------------------------------------------
00383421   1/1  apglvatplterllrl------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00515681   1/1  rgllalllllllllllll----------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00409101   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00512031   1/1  ----------------------------------------------------------------------
00512601   1/1  tpllaalla-------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00519651   1/1  ----------------------------------------------------------------------
00517631   1/1  lpll...llpeellealla---------------------------------------------------
00512791   1/1  rglll-----------------------------------------------------------------
00509551   1/1  avapglvdtpllrall.....-------------------------------------------------
00510061   1/1  lvdTpllrgllapeellealle------------------------------------------------
00506551   1/1  ----------------------------------------------------------------------
00507761   1/1  rgllallllllllllpe-----------------------------------------------------
00413661   1/1  ..................eal-------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00532861   1/1  ----------------------------------------------------------------------
00450761   1/1  apglvdTpmlaallll------------------------------------------------------
00520851   1/1  ----------------------------------------------------------------------
00482431   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00394381   1/1  gllallllllllll--------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00502371   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00523681   1/1  ----------------------------------------------------------------------
00471241   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00451531   1/1  ----------------------------------------------------------------------
00519551   1/1  ----------------------------------------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00525291   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00532661   1/1  ----------------------------------------------------------------------
00353051   1/1  ----------------------------------------------------------------------
00376621   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS---------------------------------
00519961   1/1  ipvplllllllalllefvplrpgdvprlladis-------------------------------------
00521161   1/1  lgkkipivfvp.rpgdvlrlladiska-------------------------------------------
00371281   1/1  vplragdvlrlvldiskarellgwk---------------------------------------------
00419991   1/1  alaealglpipivfvplrpgdvrrllad------------------------------------------
00383241   1/1  dDvaealllaleapaspnlalegaaggvyniggg------------------------------------
00519251   1/1  skakkllgwkpkysleeglketvewylenllld-------------------------------------
00462911   1/1  vfvplrlllllalllkllellllllll-------------------------------------------
00498641   1/1  lakllglpipivfvplrpgdvarlvldiskarel------------------------------------
00433371   1/1  rrpgdvarllldiskarellgwkpkysleegl--------------------------------------
00511831   1/1  pvsvrelaellaellgrpvpivpvpll-------------------------------------------
00400431   1/1  glpiplievpprrpgdvlrllldiska-------------------------------------------
00490261   1/1  edpaaggtgqvynlggge.vsvrelaealaeal-------------------------------------
00468971   1/1  aealglplpllpvldiliellplrpgdvlrlv--------------------------------------
00464721   1/1  pipivpvplrpgdvlallldiskare.lg-----------------------------------------
00465741   1/1  vrelaealaellglpipivpvplrpgdvlallldis----------------------------------
00491171   1/1  rpgdvlrllldiskarellgwkprysleeglrdtve----------------------------------
00460341   1/1  lpllpvplallellieflplrpgdvlrlvldis-------------------------------------
00495191   1/1  pivpvplallrllakllellllllelllrpgdv-------------------------------------
00482931   1/1  lpivpvpdplllrpgdvlrllldiskarellg--------------------------------------
00493571   1/1  aealaellglpvpgvpvpiellplrpgdvl----------------------------------------
00514911   1/1  gepvsvrelaealaellglpipivpvplrpgdvlal----------------------------------
00507211   1/1  elaealaealglpvpivfvplrpggdlayl----------------------------------------
00430421   1/1  lellrllllelgllelllllll------------------------------------------------
00491981   1/1  lakelakalglklevilvplrapgdvlllyadtskl----------------------------------
00430411   1/1  plellrllllllglpaelllll------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00482701   1/1  seyptpakrPansvldssklrealgikp.p----------------------------------------
00448531   1/1  svLdlsklkallglepp.dweeglr---------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00514401   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00436781   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00468011   1/1  ----------------------------------------------------------------------
00398711   1/1  ----------------------------------------------------------------------
00513551   1/1  ----------------------------------------------------------------------
00368061   1/1  ----------------------------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00408681   1/1  ----------------------------------------------------------------------
00482861   1/1  ----------------------------------------------------------------------
00385451   1/1  ----------------------------------------------------------------------
00498451   1/1  ----------------------------------------------------------------------
00503831   1/1  ----------------------------------------------------------------------
00528731   1/1  ----------------------------------------------------------------------
00354051   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00509671   1/1  ----------------------------------------------------------------------
00380681   1/1  ----------------------------------------------------------------------
00383421   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00515681   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00409101   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00512031   1/1  ----------------------------------------------------------------------
00512601   1/1  ----------------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00519651   1/1  ----------------------------------------------------------------------
00517631   1/1  ----------------------------------------------------------------------
00512791   1/1  ----------------------------------------------------------------------
00509551   1/1  ----------------------------------------------------------------------
00510061   1/1  ----------------------------------------------------------------------
00506551   1/1  ----------------------------------------------------------------------
00507761   1/1  ----------------------------------------------------------------------
00413661   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00517021   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00503651   1/1  ----------------------------------------------------------------------
00532861   1/1  ----------------------------------------------------------------------
00450761   1/1  ----------------------------------------------------------------------
00520851   1/1  ----------------------------------------------------------------------
00482431   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00388141   1/1  ----------------------------------------------------------------------
00394381   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00502371   1/1  ----------------------------------------------------------------------
00499421   1/1  ----------------------------------------------------------------------
00476811   1/1  ----------------------------------------------------------------------
00350181   1/1  ----------------------------------------------------------------------
00523681   1/1  ----------------------------------------------------------------------
00471241   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00474701   1/1  ----------------------------------------------------------------------
00451531   1/1  ----------------------------------------------------------------------
00519551   1/1  ----------------------------------------------------------------------
00464831   1/1  ----------------------------------------------------------------------
00380421   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00525291   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00532661   1/1  ----------------------------------------------------------------------
00353051   1/1  ----------------------------------------------------------------------
00376621   1/1  ----------------------------------------------------------------------