[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53734.1


[Show Plain Result]

## Summary of Sequence Search
   1::157
   5::159  1.3e-37 35.5% 0041137 00411371 1/1   /beta knot                              
   2::155  3.7e-37 37.0% 0044596 00445961 1/1   /beta knot                              
   1::152  1.1e-35 32.0% 0038338 00383381 1/1   /beta knot                              
   3::153    3e-34 34.5% 0047409 00474091 1/1   /beta knot                              
   1::157


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPEHPLHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLDYHDLADVTVHATFDEA
00411371   1/1  ----dllvvlvepedpgNlGaiiRtaaafgvdlvllvplgfdlldkkllraalgalellplarvtnladl
00445961   1/1  -qgvvalvrllrilslldlrklplvvvldnvqdpgNlGaiiRtaaafgvdglilvgpraf...npkvlra
00383381   1/1  lrkldlvvvldnvqdpgNlGailRtaaafgvdlvilvglradlldkkvlraalgalellplvvvdnlaea
00474091   1/1  --llellelrksplllvldnvedpgNlGailRtaaafgvd.alilplgrdlldpkvlraalgalellpva


                         -         -         *         -         -         -         -:140
query           MAAVPGRVFAFTTTANTRFTDIAFEPGDALLFGTEPTGLPQEHVEHSRITSELRIPMLPGRRSMNLSNSA
00411371   1/1  lealkdagllilttagsvsltdvdlggpvalvfGnEgtGlseellelleadllvrIPmlglvrSLNvavA
00445961   1/1  algalellplvvvddlaealedlkeagylvvattlregsvplteldlpgpvalvfGnEgtGlseellela
00383381   1/1  lellkeagllvvattlegsvllldvdlpgpvalvlGnEgaGlseellela..dllvrIPmlglveSLNvs
00474091   1/1  rvnlaealellkeagllvvattlegsvllldvdlpepvalvlGnEgkGlseellel..adllvrIPmlgl


                         +         -         -         -         -         *         -:210
query           AVATYEAWRQLGFVGGV-----------------------------------------------------
00411371   1/1  aaillyealrqlllaglle---------------------------------------------------
00445961   1/1  ..dllvrIPmlglve-------------------------------------------------------
00383381   1/1  vAaaillyealr----------------------------------------------------------
00474091   1/1  veSLNvsvAaail---------------------------------------------------------