[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF53991.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
   7::155  1.4e-20 23.0% 0052617 00526171 1/1   edoxin-like                             
   1::156  7.3e-20 29.2% 0052322 00523221 1/1   edoxin-like                             
   7::156  1.9e-15 20.1% 0038196 00381961 1/1   edoxin-like                             
   3::153    2e-15 29.6% 0051923 00519231 1/1   edoxin-like                             
   2::156  5.7e-14 26.1% 0051125 00511251 1/1   edoxin-like                             
   7::159  9.8e-14 29.6% 0052802 00528021 1/1   edoxin-like                             
   3::149  2.3e-13 27.5% 0050456 00504561 1/1   edoxin-like                             
  17::144  3.7e-13 26.4% 0039527 00395271 1/1   edoxin-like                             
   8::156  5.5e-13 34.1% 0051497 00514971 1/1   edoxin-like                             
   5::154  5.9e-13 27.2% 0043753 00437531 1/1   edoxin-like                             
   3::149  7.1e-13 25.9% 0048298 00482981 1/1   edoxin-like                             
   6::140  1.6e-12 28.6% 0048033 00480331 1/1   edoxin-like                             
   1::158  1.7e-12 27.9% 0051123 00511231 1/1   edoxin-like                             
   2::142  1.7e-12 29.4% 0052340 00523401 1/1   edoxin-like                             
  19::152  2.2e-12 34.2% 0050985 00509851 1/1   edoxin-like                             
  22::149    3e-12 28.3% 0049009 00490091 1/1   edoxin-like                             
   1::155  3.2e-12 29.5% 0048908 00489081 1/1   edoxin-like                             
   2::162  6.4e-12 27.8% 0051703 00517031 1/1   edoxin-like                             
   5::149  6.5e-12 28.4% 0050002 00500021 1/1   edoxin-like                             
   5::149  6.6e-12 27.0% 0051667 00516671 1/1   edoxin-like                             
   1::157  6.8e-12 26.2% 0048812 00488121 1/1   edoxin-like                             
   1::149  6.8e-12 31.1% 0051602 00516021 1/1   edoxin-like                             
   2::156  8.3e-12 25.9% 0041722 00417221 1/1   edoxin-like                             
   1::158  1.1e-11 26.2% 0040163 00401631 1/1   edoxin-like                             
  17::149  1.5e-11 28.8% 0046445 00464451 1/1   edoxin-like                             
   1::160  3.5e-11 28.0% 0047173 00471731 1/1   edoxin-like                             
   5::139  6.2e-11 30.7% 0048388 00483881 1/1   edoxin-like                             
   4::142  1.6e-10 22.8% 0042825 00428251 1/1   edoxin-like                             
  16::154  2.4e-10 30.1% 0051671 00516711 1/1   edoxin-like                             
   5::139  2.5e-10 26.0% 0048990 00489901 1/1   edoxin-like                             
  13::142  2.9e-10 27.0% 0052893 00528931 1/1   edoxin-like                             
   1::139  6.4e-10 24.4% 0041935 00419351 1/1   edoxin-like                             
  23::142  7.7e-10 27.8% 0047310 00473101 1/1   edoxin-like                             
   5::160  8.7e-09 27.2% 0050770 00507701 1/1   edoxin-like                             
   8::156    1e-08 20.9% 0037799 00377991 1/1   edoxin-like                             
  26::155  4.9e-08 30.4% 0051504 00515041 1/1   edoxin-like                             
   4::142  1.9e-07 27.6% 0048804 00488041 1/1   edoxin-like                             
   5::139  2.5e-07 28.1% 0049667 00496671 1/1   edoxin-like                             
   6::139  4.6e-07 25.6% 0052983 00529831 1/1   edoxin-like                             
   6::156    5e-07 28.5% 0051931 00519311 1/1   edoxin-like                             
  19::145  7.8e-07 28.2% 0043030 00430301 1/1   edoxin-like                             
   5::140    9e-07 26.6% 0052012 00520121 1/1   edoxin-like                             
   7::156  1.2e-06 21.6% 0035499 00354991 1/1   edoxin-like                             
  11::151  1.5e-06 25.0% 0046603 00466031 1/1   edoxin-like                             
  14::155    3e-06 24.8% 0049048 00490481 1/1   edoxin-like                             
   4::156  3.5e-06 23.3% 0049377 00493771 1/1   edoxin-like                             
  12::155  4.4e-06 28.0% 0046295 00462951 1/1   edoxin-like                             
   1::155  5.4e-06 22.8% 0050950 00509501 1/1   edoxin-like                             
   4::156  1.9e-05 25.7% 0049089 00490891 1/1   edoxin-like                             
   5::156    2e-05 24.1% 0049633 00496331 1/1   edoxin-like                             
   6::149    2e-05 23.1% 0048146 00481461 1/1   edoxin-like                             
   7::154  2.7e-05 24.8% 0051129 00511291 1/1   edoxin-like                             
  14::142  5.3e-05 23.3% 0049496 00494961 1/1   edoxin-like                             
   6::156  0.00027 21.0% 0049857 00498571 1/1   edoxin-like                             
  12::161  0.00027 22.8% 0045739 00457391 1/1   edoxin-like                             
  14::154  0.00029 23.1% 0037474 00374741 1/1   edoxin-like                             
   4::156  0.00035 23.1% 0051914 00519141 1/1   edoxin-like                             
   6::155  0.00035 24.1% 0049632 00496321 1/1   edoxin-like                             
  12::155  0.00067 24.5% 0046982 00469821 1/1   edoxin-like                             
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
00526171   1/1  ------ksapdftlpdlldgepvslsdlrGkvvLlvfwaswCgpcpke.ypgleelyekygdkglvvlgv
00523221   1/1  llsplllvgdpapdftlpdl.dGktvslsdlkGkvvlvvfwatwCppCkae.lpeleelaeeykd.gvvv
00381961   1/1  ------qsapdftltdlldgkpvslsdlkGkvvllvfvaswCglcrpe.ypeLeelyekykdkglvvlgf
00519231   1/1  --llvgdpaPdftlpvldldgktfsladlkgkpvlvnFwatwCppCkae.lpeleelaeeykd.gvvvvg
00511251   1/1  -lllvgdpapdftltdl.dgkpvslsdlkgdkvvllffwPatwCpvC.ttelpalaelaeelkdkgvevl
00528021   1/1  ------lPapdftlvd.ldgetvslsdlkgkpvlvdfyaswCppCkte.lpaleelaeelkdkgvvvlgv
00504561   1/1  --slvgdpapdftltdl.dgklellpvslsdlkGkvvllffwPatwCpvCpte.lpalaelaeefkdkgv
00395271   1/1  ----------------dldgkevslsdlkgkpvlvdfyatwCgpCkae.apeleelakelkdkgvvvvgv
00514971   1/1  -------Pdftlkdl...dgetvsladlkgkpvlvdfwatwCppCrae.lpaleelaee....gvvvvgv
00437531   1/1  ----vgdpapdfeltdl.dgkevslsdlkgkpvlldfyaswCppCkte.apeleelaeelkdkgvvvvgv
00482981   1/1  --slvgdkapdftlpalldtdgktvslsdlkGkvvvlffwPatwcpvC.ttelpalaelydefkdkgvev
00480331   1/1  -----Gdpapdftlvdl.dgetfdladlkgkpvlvdfwatwCppCkae.apvleelaeelk..gvvvvgv
00511231   1/1  alvlllglaldlvgalllvgdpapdftltd.ldGkpvslsdlkGkvvllffwpaswcpvCt.telpalae
00523401   1/1  -lllvgdpapdftltdl.dgktvslsdllkkgkvvllffwPatwCpvCt.telpalaelaeelkdkgvev
00509851   1/1  ------------------kvgdpaPdftlpalvldlgllldldgkplsledvslsdllkgkvvvlffyPa
00490091   1/1  ---------------------sgmllvgdpapdftltdldgkgelltvslsdlkGkvvllffwPatwCpv
00489081   1/1  tlllllllvslagalllvgdpapdftltd.ldgktvslsdlkGkvvllffwpaswcpvCt.telpalael
00517031   1/1  -slplllvgdkapdftlpdl.dgktvslsdllkgkvvvlnFiyPatwCpvCtt.elpalaelyeefkdk.
00500021   1/1  ----GllkvgdpaPdftl...tdldgkgeflpvslsdlkGkvvllffwPatwCpvCp.telpalaelyde
00516671   1/1  ----dpapdftltdldgkglltvslsdlkGkvvllffwPatwCpvCp.telpalaelydelkdkgvevlg
00488121   1/1  llllllllvlllgalllvgdpapdftltd.ldgktvslsdlkGkpvllffwatawcppCpte.lpalael
00516021   1/1  llvgdkapdftl...pdldgktlllldvslsdllkgkvvvlffwPatwcpvCt.telpalaeladelkdk
00417221   1/1  -lllvgdpapvfeltdl.dgeevvlsdlkgkpvlvyFwaswCppCkal.apvleelaekykdekgvvvvk
00401631   1/1  lllsllvgkpapdfslvdl.dgenfdlavlkgkpvlvdfwaswCgpCkala.pvleelakey...gvvvv
00464451   1/1  ----------------GallvgdkapdftltalledldgktvslsdlkgkvvllffwPatwCpvC.ptel
00471731   1/1  msllvgdkaPdftlltdldgktvslsdllkgkvvvlffyPaafcpvCttehlpalaeladefkklgvevv
00483881   1/1  ----lkvgdkaPdftlpalldldgktvslsdllkgkvvvlffyPaaftpvCttehlpalaeladefkalg
00428251   1/1  ---lvgkpapdfslvdl.dgeefdlavlkgkpvlvdFyaswCgpCkal.apvleelaeelkgekgvvvvk
00516711   1/1  ---------------slPalpdftlvdldgetvsladlkgkpvlvdfyaswCppCkae.apeleelaeel
00489901   1/1  ----vgmmllvGdpaPdftlpavvdtdgktvslsdfkGkvvvlffyPadftpvCt.telpalaelaeefk
00528931   1/1  ------------AP.ftltdldgktvslsdlkGkvvllffwatwcppvCptelpalaelyeelkdrllad
00419351   1/1  aaaltllevgdpapdftltd.qdGktvslsdlkGkvvllyfyatwcppvCptelpeladlykklkdkgkd
00473101   1/1  ----------------------AevgdpapfslkdldgetlevslsdlkgkpvlvdfwatwCppCkae.a
00507701   1/1  ----lmmmllvGdkaPdftlptt...dgefktvslsdlkGkwvvLffyPadfTpvCt.telpafadlyde
00377991   1/1  -------alltegkdytvllgp.....psgkpvvveFfaywCphCkkfeptlevleklakklpddgkvkv
00515041   1/1  -------------------------lllllrlllllkslllllllllallvgdpapdftlpdldgkvvsl
00488041   1/1  ---llvGdpaPdftlpd.ldGk.vslsdlkgdkvvvlffyPatfcpvCtt.elpalaeladefkakgvev
00496671   1/1  ----lmsllvgdkaPdftllallpdtdgktvslsdlfkgkkvvlffyPaaftpvCttehlpaladladef
00529831   1/1  -----kaPdftlpavlldtdgktvslsdlkggkkvvlffypadftpvCt.telpafadlydefkkkgvev
00519311   1/1  -----eigklapdft.ltdqdGktvtlsdlkGkvvllyfgftdCpdvCpteladlaelyeelkdllgddv
00430301   1/1  ------------------dgeevslsdfkgkkvvlffyPadftpvCtteapefnelaeel.k..gvevlg
00520121   1/1  ----llllllllllvllagmlllvgdkapdftlt...dtdgktvslsdlkgkwvvlffyPatftpvCtt.
00354991   1/1  ------vellegkdfdvvlgs......asgkpvlveFfapwCphCkala.pvleelaeelpd.kvkfvkv
00466031   1/1  ----------dlsvieltglenfdlallkakaegkpvlvdfyapwCgpCk.alapvleelaeelkg.gvv
00490481   1/1  -------------avieltgenfdlallkgkpvlvdfwapwCgpCkala.pvleelaeelkd.gvvfvkv
00493771   1/1  ---Llglaappvtlldl..gealelallsgkpvlvdfyapwCgpCkala.peleelaeeyk.gnvvfvkv
00462951   1/1  -----------lsvveltgenflslvllsgkpvlvdfwapwCgpCkala.pvleelaeelkd.gvvfvkv
00509501   1/1  lllevgkpapdfsvvdl.d.enfdlavlkgkpvlvdfyapwCgpCkal.apvleelaeelkg..vvfvkv
00490891   1/1  ---lslpaapdftvvel.tgenfdlallsgkpvlvdfyapwCgpCkala.pvleelaeel..pgvvfvkv
00496331   1/1  ----aegkpapdfsvvel.tgenfdlavlkgkpvlvdfwapwCgpCkal.apvleelaeelkg..vvfvk
00481461   1/1  -----dlPafsgavvel.tgenfdlalasgkpvlvdfyapwCgpCk.alapvleelaeeykglnkgvvfv
00511291   1/1  ------aglpapdv.vlltldgfdelladlsgkpvlvdfyapwCgpCk.alapvleelaeelkd.gvvfv
00494961   1/1  -------------svveltgeanfdlallegkpvlvdfyapwCgpCk.alapvleelaeel..dgvvfvk
00498571   1/1  -----aegqpapdfvvlltldgfalaladlsgkpvlvdfwaswCgpCkal.apeleelaeeyklldgvvv
00457391   1/1  -----------lspvleltdlnfldevlsdlsgkpvlvdfyapdwCgpCk.alapvleelaeeykglgvv
00374741   1/1  -------------vleltddnflelvlksgkpvlvdfyapwCgpCkal.apvleelaeeykg.gvvfvkv
00519141   1/1  ---lsellalpdfsvveltgenfdlallegkpvlvdfyapwCgpCk.alapvleelaeelkgkgvvfvkv
00496321   1/1  -----sgpvieltdenflelv.....llsgkpvlvdfwapwCgpCkala.pvleelakelkd.gvvfvkv
00469821   1/1  -----------lpvvvlltlenfdelladlkgkpvlvdfwapwCgpCkal.apvleelaeel..dgvvfv


                         -         -         *         -         -         -         -:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQ
00526171   1/1  pcdqfggqepgsneeikeflkyvrpglkygvtfpllakidvnganahplykflkaalggllgdsllllel
00523221   1/1  vgvsvndfgnqeddspeelaafaekygltfplllDedge......vakaygvrgtPttflidkdGkvvyr
00381961   1/1  pcnqfgsqepgsneeilefckvvkfllkygvtfplfekidvnGenahplykflkealpglldedgklaka
00519231   1/1  vnvdll.geedspealkkflkelgldfpvlld......edgelakaygvrgtPttflidkdGkivarlvG
00511251   1/1  gvsv..dd.....pevlkaflekfglpfpllsdivpdge....lakaygvlvekglvalpatflidpdGk
00528021   1/1  .svdsfperdspeelkefleklgvlnfpllsdenge......lakaygvlgiPtlflidkdGkvvarfvg
00504561   1/1  evvgvsv.....d..dpedhkaflkkygalfglnfpllsDpdgelakaygvlvgylglalpatflidpdG
00395271   1/1  dvden.....speelkaflkkfgltfplll.gdvdgilagelakaygvrgiPtlflidkdGkvvaryvga
00514971   1/1  nvd......dspeavkaflkelglpfpvllldpdge......lakaygvrgiPttflidkdGkivarlvg
00437531   1/1  svd......dspeslkaflkkyglpfpllad......engelakaygvlgiPtlflidkdGkvvaryvga
00482981   1/1  lgisv..ddpedh.kaflkkyaklfglnfpllsDpdgevakaygvlggllgralpatflidpdGkiryrf
00480331   1/1  dvd......dnpealkkfleklglpfpllsdpdg......alakaygvrgiPttflidkdGkivarlvga
00511231   1/1  laeel...gvevvgvsv..dd.....pevlkaflekfglpnfpllsdpd......gelakaygvlledgg
00523401   1/1  vgvs.vdd......pealkaflekfglpfpllsdpdge......lakaygvllegllgylvlglpatfli
00509851   1/1  twcpvCttvelpalaeladeflkdkgvlevvgvsv.....d..spevlkaflkklgllpfpllsDpdgel
00490091   1/1  C.ptelpalaelyeelkdkgvevvgvsv.....d..dpfdhpafleeylkffglnglpfpllsDpdgela
00489081   1/1  aeelk..gvevvgv.svdd......pealkaflekfgldnfpllsdf.pdg....elakaygvlledggy
00517031   1/1  vevvgisv.....d..spevlkaflkklglnfpllsDpdg......elakaygvlggllglalpatfli.
00500021   1/1  fkdkgvevvgvsv.....d..dpfdhpaflkeylkffglyglpfpllsDpdgelakaygvlvgylglalp
00516671   1/1  vsv.....d..dpfdhpaflkeylkffglgglnfpllsdpdgelakaygvlggylglalpatflidpdGk
00488121   1/1  aeelk..gvevvgvsv..dd.....pealkaflkkfgllnfpllsdvpdg.....elakaygvlggylgl
00516021   1/1  gvevvgisv.....d..dpfdhkaflkkylklfglgglpfpllsDpdg......elakaygvlvekglgl
00417221   1/1  vdvd......dnpeelkeflkklglpfpllldpdvl....gelakaygvrgiPtlvlidkdGkvvaryvg
00401631   1/1  kvdvd......dsaeevkeflkkyglpfpvllgdeng......elakkygvrgiPtlflfdkdGkvvary
00464451   1/1  palaelydelkdkgvevlgvsv.....d..dpfdhpaflkeyleffglgglnfpllsdpdgelakaygvl
00471731   1/1  lgvsv..dd.....pevlkafaeklglpnnfpllsDpdge......vakaygvliekdllgleylglalr
00483881   1/1  vlevvgvsv..dd.....pevlkafaeklgldpfpllsDpdgevakaygvlieksglgllvlglpatfl-
00428251   1/1  vdvdenrdt......lkkflkklglpfpllldp....dvikelakaygvrgiPtlflfdkdGkvvaryvg
00516711   1/1  ..dgvvvvgvsvd......dspelakkflgvfglptfpllsdpgge......varaygvlalpttflidp
00489901   1/1  klgvevlgvsv.....D..spfshkaflkkivelfglgglnfpllsDpdgevakaygvlielgglalra-
00528931   1/1  gvevlgvsvd.perd..spealkaflekfglpfplltgksdvdgelakaygvllkkeglgllldylvdhl
00419351   1/1  vevlgvsvd.perd..tpeelkaflkkfgltfplligltgdladdldkalakaygvlyekkglgylvdh-
00473101   1/1  peleelaeelkeddgvvvvgvsvd......dspelakkfvegyp.tfplllsd....gdvvgelagaygv
00507701   1/1  fkklgvevigvSv.....D..spfshkawaetikelgklglpfpllsDpdg......evakaygvliekg
00377991   1/1  vkvdvplgpnsllaaraaaaakalgkfwklhdalfeaqfeegtnl.dlevllkiakeagldaekflaaln
00515041   1/1  sdnFdelkgkpvlv..FfgllWCgpCkal.apvl.elaeelkd.gvvvvkvdv.....d.enpelakkfl
00488041   1/1  vgvsv.....d..dpfdhkaflkkygalfdealllglpfpllsDpdge......vakaygvliekdglgf
00496671   1/1  kklgvdevlgvsv..dd.....pfvhkafleklglpnkfpllsDpdg......evakaygvlveksglg-
00529831   1/1  lgvsv.....d..spfshkaflkkylklfglgglnfpllsDpdgevakaygvllek.glalratflidp-
00519311   1/1  qvlfv.svDperd..tpevlkeyaekfgpdfpgltg...dpeeikelakaygvyyekvglgdvdgdylvd
00430301   1/1  vsv.....d..spfshkafaekeglnfpllsDplrnge....lakaygvlgepsllgglalRatflidkd
00520121   1/1  elpafaelydefkdlgvevlgvSv.....D..spfdhkaflkkylklfglnfpllsdpdgevakaygvli
00354991   1/1  dvdllggpnsllaaraalaaaalgkflklhdalfeaqfeegldlsdlevllkiaaeagldaaaflaalns
00466031   1/1  fvkvdvden..................................pelakkygvrgvPtlllfd.dGkevar
00490481   1/1  d..................................vdenpelakkygvrgiPtlllfd.dgkivaryvGa
00493771   1/1  dvdrenpd.................................laqkygvrggliPtlvlfdkdGkvvaryv
00462951   1/1  dv..................................denpelakkygvrgiPtlllfd.dgkivaryvGa
00509501   1/1  dvden..................................pelakrygvrgvPtlllfd.nGkevaryvGa
00490891   1/1  d..................................vdenpelakkygvrgvPtlllfd.nGkevaryvGa
00496331   1/1  vdvden..................................pelakkygvrgiP.tlllfkdGkevaryvG
00481461   1/1  kvd..................................vdenpelakkygvrgvPtlllfdnggklevary
00511291   1/1  kvdv..................................denpelakrygvrgiPtlllfd.nGkevaryv
00494961   1/1  vdv..................................denpelakkygvrgiPtlllfd.nGkevaryvG
00498571   1/1  vkvdv..ddrp............................dengelakkygvrgiPtlvlfdkdGkivaal
00457391   1/1  fvkvdvd..................................enpelaekygvrgvPtlllfd.dGkevdl
00374741   1/1  dv..................................denpelakrygvrgiPtlllfk.ngkevaryvGa
00519141   1/1  dvdenp..................................elakkygvrgvPtlllfd.dGkevallryv
00496321   1/1  d..................................vdenpelakkygvrgiPtlllf.kdGkevaryvGa
00469821   1/1  kvdvden..................................pelakkygvrgiPtlllf.kdGkevaryv


                         +         -         -         -         -         *         -:210
query           VDDFVLGLLLGSLLSETDET--------------------------------------------------
00526171   1/1  lkllllklakaygik-------------------------------------------------------
00523221   1/1  gvgdlsrkvlgevdae------------------------------------------------------
00381961   1/1  fgvlvlkpllgndikw------------------------------------------------------
00519231   1/1  aldaeeleealek---------------------------------------------------------
00511251   1/1  vvyrfvgelnpldler------------------------------------------------------
00528021   1/1  aldpedleelle..lqlvd---------------------------------------------------
00504561   1/1  kvryrfvge-------------------------------------------------------------
00395271   1/1  ldae------------------------------------------------------------------
00514971   1/1  aldaeeleelleklle------------------------------------------------------
00437531   1/1  rdadellellekll--------------------------------------------------------
00482981   1/1  vgplpvgrl-------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00511231   1/1  ygvlhlpatflidpdGkv----------------------------------------------------
00523401   1/1  dp--------------------------------------------------------------------
00509851   1/1  ......akaygv----------------------------------------------------------
00490091   1/1  kaygvlggy-------------------------------------------------------------
00489081   1/1  lvlhlpatflidpdG-------------------------------------------------------
00517031   1/1  kdgkivyvfvglldplslerlv------------------------------------------------
00500021   1/1  atflidpdG-------------------------------------------------------------
00516671   1/1  vvyrfvgel-------------------------------------------------------------
00488121   1/1  alpatflidpdGkvvyr-----------------------------------------------------
00516021   1/1  patflidpd-------------------------------------------------------------
00417221   1/1  ardaeeleeflekllk------------------------------------------------------
00401631   1/1  vGaldaeeleefleklle----------------------------------------------------
00464451   1/1  vgylvlglp-------------------------------------------------------------
00471731   1/1  atflid.dgkiryv...lvg--------------------------------------------------
00483881   1/1  ----------------------------------------------------------------------
00428251   1/1  ar--------------------------------------------------------------------
00516711   1/1  dgkv.aryvggldp--------------------------------------------------------
00489901   1/1  ----------------------------------------------------------------------
00528931   1/1  pa--------------------------------------------------------------------
00419351   1/1  ----------------------------------------------------------------------
00473101   1/1  lg--------------------------------------------------------------------
00507701   1/1  gllalRatflidpdGkiryv--------------------------------------------------
00377991   1/1  sfavkalvdaneelae------------------------------------------------------
00515041   1/1  ekgvlgfPtlldfk.-------------------------------------------------------
00488041   1/1  gy--------------------------------------------------------------------
00496671   1/1  ----------------------------------------------------------------------
00529831   1/1  ----------------------------------------------------------------------
00519311   1/1  hspttflidpdGriva------------------------------------------------------
00430301   1/1  gkvvy-----------------------------------------------------------------
00520121   1/1  ----------------------------------------------------------------------
00354991   1/1  davkalveeneelaek------------------------------------------------------
00466031   1/1  yvGadaeelle-----------------------------------------------------------
00490481   1/1  ldaeelleflkkllk-------------------------------------------------------
00493771   1/1  Galdaeelleflekll------------------------------------------------------
00462951   1/1  ldaeelleflkkllk-------------------------------------------------------
00509501   1/1  .daeellefleklla-------------------------------------------------------
00490891   1/1  .daeelleflekllge------------------------------------------------------
00496331   1/1  a.daeeleeflkklll------------------------------------------------------
00481461   1/1  vGaldaeel-------------------------------------------------------------
00511291   1/1  Ga.daeelleflek--------------------------------------------------------
00494961   1/1  a.--------------------------------------------------------------------
00498571   1/1  ryvGaldaeelleflk------------------------------------------------------
00457391   1/1  ryvGardaeelleflekllgl-------------------------------------------------
00374741   1/1  rdaeelleflekll--------------------------------------------------------
00519141   1/1  Galdaeelleflekll------------------------------------------------------
00496321   1/1  ldaeelleflekllk-------------------------------------------------------
00469821   1/1  Ga.daeelleflkkl-------------------------------------------------------