[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54079.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
   1::173  8.6e-38 32.6% 0049507 00495071 1/1   proteins                                
   2::180  7.9e-34 35.7% 0048395 00483951 1/1   proteins                                
   2::174  1.7e-33 34.3% 0049241 00492411 1/1   proteins                                
   1::179  1.8e-28 27.3% 0049022 00490221 1/1   proteins                                
   1::179  4.5e-27 31.0% 0049640 00496401 1/1   proteins                                
   1::175  9.3e-26 27.2% 0049548 00495481 1/1   proteins                                
   3::177  8.8e-25 28.4% 0049201 00492011 1/1   proteins                                
   1::182    3e-24 27.0% 0051281 00512811 1/1   proteins                                
   1::179  2.3e-21 24.7% 0043718 00437181 1/1   proteins                                
   1::173  4.7e-21 25.0% 0046417 00464171 1/1   proteins                                
   1::186  6.1e-21 25.9% 0052813 00528131 1/1   proteins                                
   1::173  1.2e-20 26.2% 0042957 00429571 1/1   proteins                                
   1::181  3.1e-19 27.2% 0051705 00517051 1/1   proteins                                
   1::179  3.6e-16 24.5% 0036778 00367781 1/1   proteins                                
   1::172  4.7e-16 27.3% 0046267 00462671 1/1   proteins                                
   1::179  7.3e-16 27.6% 0051820 00518201 1/1   proteins                                
   2::184  6.4e-12 26.7% 0051274 00512741 1/1   proteins                                
   1::170  1.4e-11 22.1% 0044895 00448951 1/1   proteins                                
   2::145  3.9e-07 26.7% 0051357 00513571 1/1   proteins                                
   3::175  4.5e-07 21.5% 0052810 00528101 1/1   proteins                                
   2::172  5.1e-07 25.2% 0045773 00457731 1/1   proteins                                
   4::175  5.1e-07 20.6% 0053358 00533581 1/1   proteins                                
   2::172  9.8e-07 25.5% 0036210 00362101 1/1   proteins                                
   2::119  5.6e-05 25.0% 0046862 00468621 1/1   proteins                                
   1::172  0.00031 22.2% 0048535 00485351 1/1   proteins                                
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
00495071   1/1  M.kiliivgsprkgsntralaeaaaegleeallelhpgaevelidladlnlPlldedllgallcltegqc
00483951   1/1  -mkilvivGSlrkgsnnrklaealaellee.agaevelidladlnlplldgc.........pddvqelre
00492411   1/1  -mkilvivgSlrkgsntrklaeaaaellee..gaevelidladlplplldgdleg.....lpddvqelle
00490221   1/1  Msm.kiliiygSprkgsntralaeaaaegleea.gaevelidladldldpcldcdlcaakgkcvelltla
00496401   1/1  smmkiliiygSprlkgsntralaeaaaegleealpgaevelidladldlPlldedlcigcfaclkelseg
00495481   1/1  MkkiliiygSprlkgsntralaeaaaegleealpgaevelidladlplppcdgclecalktgacvlpddv
00492011   1/1  --KiliiygSprkgsntralaeaaae......gaevelidladldlppclgdlecakgkcplpddveall
00512811   1/1  aPM.kiliiygSpr..gnteklaeaiaeglee.agaevelidladlplppclgdlecltegecvlpddve
00437181   1/1  M.KvlviygSprgknsntrklaeaaaeglee..gaevevidladlpippclgcllcalgfkdgkcaqkva
00464171   1/1  mmmkiLiinasprenslsraladaalegleeagh.evevldLydlpfdpcldcddcaakftppegltaeq
00528131   1/1  llledllllddlpvldldllllidllellimstpm.kilvlygSprrgsntrklaeaaaegleaa.gaev
00429571   1/1  mmmkiliingspregsntralaeaaleglke.pgaevevidLydlnidpcldcddcaallkppegltlsl
00517051   1/1  MmkilvvygSpr..gnTeklaeaiaegaee.agaevelidvaelplpeclacgdcplk....ddlealle
00367781   1/1  mmmkvlivygSmy..gnteklaeaiaeglre.agvevelidlsdtdl...................dell
00462671   1/1  mmmkiLiingspregsltraladaalegleeagh.evevidLyalpfdpcldcddcaalftppegltpeq
00518201   1/1  MmkiliiygSpt..GnTeklaeaiaegleavagvevelidvsdadp.......................e
00512741   1/1  -gekkilvlygSlt..gntellaealaeglea.agvevelvdladldlpdl...................
00448951   1/1  kkmkkvlivygSmy..gnteklAeaiaeglke.agvevelldlseldapeile................l
00513571   1/1  -AkililygS..qtGnTeklAeaiaegleea.gv.velidldead.......................le
00528101   1/1  --KvlivYgSmt..GnTeklAeaiaeglge.agvevelldladadp.......................e
00457731   1/1  -mkililYgSlt..GnTeklAeaiaeglg...gaevelidlddad.......................le
00533581   1/1  ---ilivYgSmt..GnTeklAeaiaeglee.agvevellnlsdadp.......................e
00362101   1/1  -mkililYgS..qtGnTeklAeaiaeglge..gvevdlvdledadl.......................e
00468621   1/1  -gKililYgS..qtGnTeklAeaiaegle.....evdlidldd.......................adle
00485351   1/1  MmkilIlYgSqt..GnTekvAeaiaeglgaag...velvdlddad.......................le


                         -         -         *         -         -         -         -:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELQIAHVQK
00495071   1/1  alpddvaeliekllaaDalvfvtPeYngsiPalLKnfiDrvsrplkgKpvllvstsgggglrallylrti
00483951   1/1  kiaeaDaivlvtPeYngsipgaLKnalDwlsrpwlagkpvalvavsgggsgglraleqlrqvlaflgalv
00492411   1/1  kllaaDglvfatPeYngsipglLKnalDrlsrpggkllagKpvalvstsggalgglraleqlrlilgflg
00490221   1/1  qeellalkegllpddvaellekllaaDaivfgtPvyngsvpaqlKnfiDrvlragfafgygglgpvgllk
00496401   1/1  ecvlpddvaallekllaaDaivfgtPeyngsvpallKnfiDrvlrpgfafgygglgpvgllkgKpaalvv
00495481   1/1  qallalsdallekllaaDaivfgtPeyngsvpallKnfiDrvlragfafgytglggggllkgKpaalivt
00492011   1/1  ekllaaDaivfgtPeyngsvpaqlKnfiDrvsrlgfafgydgpggllkgKpaalvvtsggpgggylesal
00512811   1/1  elleklleaDaiilgtPtyngsvpaqlknflDrvlrlgfggllkgKpaalfgtsggpgggaerallqlrt
00437181   1/1  ddv.aelleklleaDaivfgsPvyngsvpaqlKafiDrlsrlgpvgllkgKvvavvttsggggaeaalqy
00464171   1/1  eealalgecvlkddvaeeqekllaADvivfafPlywfgvPalLKgwiDrvlragfafgytgdgpvgllkg
00528131   1/1  eiidladlplplgcidclp.......ddvaelledllaadgivvgsPtyngsmpallKnflDrllllggs
00429571   1/1  eealalgecalpddveellekllaaDaivfafPlYwfsvPallKnfiDrvlragfafgytgngpegllkg
00517051   1/1  dlleaDgiilGsPtyfgsvsaqlkafldrlsrlwlsgalagKpaavftssggsgggqetallslrtlllh
00367781   1/1  eelldadaiilGsPtynggvlpqlknfldalsgldlkgKpvavfgsggg.sgeavdllrellkelgakvv
00462671   1/1  kqalalgkcplpddvealqekllaADaivfafPlywfsvPallKgwiDrvlraGfafgyggngpvgllkg
00518201   1/1  dlleaDgiilGsPtygggvpgqlkdfldrlsglwlgllkgKpaavfgsgggsgggfedalkylrkllkel
00512741   1/1  leelldadalvVgsPtyngsipgllkafldrllglglkgkkvavfgsgggsg.gavkqlrellaelgalv
00448951   1/1  leelldadalilgsPtyggeippqlkdfldllgglalkgKlaavfgsggwfgg.avktleellkelgakv
00513571   1/1  dleeadaiifgtptygfGelpdnlkafldrtfydfleglkglllkgkkyavfglgdslgygeefcaaakk
00528101   1/1  dlldadalilgtptygggelpddlvkdfldllkldlkgkkvavfgsggsgfgdalklldellkelgakvv
00457731   1/1  dleeydaiilgtptygygelpdnlkdfldellgldlsgkkvavFglgdssgggeefcealklldkllael
00533581   1/1  dlldydaiilgsptygggeppedevkdfldrllgklkgkkvavfgsggsgfgealklleellkelgakvv
00362101   1/1  dlleydaiilgtptygygelpdnlkdfldfllkldlkgkkvavfglgdssggyeefcaalkkldkrlael
00468621   1/1  dlleydaiilgtpTygfGelpdnakdfldalkgldlkgkkyavfglGds---------------------
00485351   1/1  dledydliilgtptygagelpdnlkdfldelkeldlsgkkvavFglgdssryygwfgeavklldkllkel


                         +         -         -         -         -         *         -:210
query           TGLLSIFTDFEYPNFKPSEQGISSVDAMLEQLVVWTKAMSTIRESANV----------------------
00495071   1/1  lgflgatvvpsvvalgvaagelfdedgeltdee-------------------------------------
00483951   1/1  ipsqvlilgag.fdedgvltdeellerledlldelvkllk------------------------------
00492411   1/1  avvvpsvvvalgkalelfdedgllldeellerlk------------------------------------
00490221   1/1  gKpaalvvtsggpggayaaggaegtlrqlltpllrgilg-------------------------------
00496401   1/1  tsggpggglaaetalrplltilgflgmtvvglvlaegv.-------------------------------
00495481   1/1  sggpggglaaesalrylltilgflgmpvvglvlae-----------------------------------
00492011   1/1  rylrtilaflgmtvvgsvyaegv....dfgevekdee---------------------------------
00512811   1/1  ilaflgmivvglglaigvafdafgaplgastlaggvlldede----------------------------
00437181   1/1  lrtilaflgmivvglvyaegvll.gpgdevllgsaygaf-------------------------------
00464171   1/1  KkallivtsGgpeeaysegggagalldlllpyl-------------------------------------
00528131   1/1  vgllagKpaavfvtgggsggelaleqlrtllahlgmivvp....pg------------------------
00429571   1/1  Kkvllvvtsggpeeaysaggpnggvddlltpll-------------------------------------
00517051   1/1  lgmivvglglavgglldefrggspygastfagidg.gvlpd-----------------------------
00367781   1/1  gepllv.........kgapdeedletaeelgkrlaellk-------------------------------
00462671   1/1  KkalvivtsGgpeeayseggpaggledlllpy--------------------------------------
00518201   1/1  gmivvglgyfagalggspygallaeg.........apde-------------------------------
00512741   1/1  vplgvllv........dedpdeealerieelgeelakll.....--------------------------
00448951   1/1  v.plleikgspt....dleeleelgkelak----------------------------------------
00513571   1/1  ldkll-----------------------------------------------------------------
00528101   1/1  geglii............pdeedlekarelgkrla-----------------------------------
00457731   1/1  gakvvgeglladydfeasfalwldglfiglal--------------------------------------
00533581   1/1  glpllag..........vpdeedlerarelgkrla-----------------------------------
00362101   1/1  Gakrvgegllidysfddskavlggsfvglald--------------------------------------
00468621   1/1  ----------------------------------------------------------------------
00485351   1/1  gakvvgeglfigylfynsyalfdglfvglald--------------------------------------