[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54082.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
   1::393  2.2e-66 27.7% 0042501 00425011 1/1   eneral substrate transporter            
   1::391  1.8e-60 28.6% 0042480 00424801 1/1   eneral substrate transporter            
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSEYNASASKSTKLILTALALGVFGVGVTEFVPVGLLPQIANTFDTSIATTGWVISSYAAGVMVGAPIMT
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff
00424801   1/1  Mkekr.......rrvllllflgyflsgldfgligpllplilkdflglsaaqigllfsayllgaalgspla


                         -         -         *         -         -         -         -:140
query           LLSIRRPRKQMLIILMVLFIIGNLLSAVAPNFALLIIGRIVTSFTHGAFFGIGTVVAAELAGPGQRGAAV
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglfpaala
00424801   1/1  GrlsDrfGrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaalaliaelfppee


                         +         -         -         -         -         *         -:210
query           AYMFSGISLANLIGVPIGTWIGTMANWRTTFLVIAALGILTAVAIAYLVPNLPSPKNVRVGREIKALTHP
00425011   1/1  llaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllalllllllpespr
00424801   1/1  rglaleygllsaggslGallgpllggllld.lgwrlvfliaailalllllllllflpesprflaakgkle


                         -         -         -         +         -         -         -:280
query           QVILALLMTLFGFGGVFAALTYLTPIMTDIAGYAESSMSWILIIVGVGMFTGNWTGGKLADRSLIPSVLA
00425011   1/1  flllkglseeerkvlerrlkadaeakaasplsllellrnprflllllayfllflgfyglltflplylqev
00424801   1/1  eekkaslklslkellknprllllllavfllflgfyalltylplylqslfevlglsasqaglllalfglgg


                         -         *         -         -         -         -         +:350
query           MLFLLAATLFAFNFTAHSAILSLITIFFIGFFGMATVAPLQSVVLEYAKGAPTLASSINIGVFNLGNAVA
00425011   1/1  lglsasqaglllalfglggilgsllagrlsdrlpegrrrrllliglllaalgllllallpgt.slallll
00424801   1/1  ilgsllagrlsdrlgrrrllligllllalgllllal.apslwllllllillgfgfglafpllfallself


                         -         -         -         -         *         -         -:420
query           AWLAGATITTSLGLTSAGLVGGLMTSLGLVLAIVAVVLRRKAQETRTTISVVEQQPAA------------
00425011   1/1  llfllgfglggafpllfalvaelfppelrgtasgllnlagnlg---------------------------
00424801   1/1  ppelrgtalgllnllagslggalgpllagllldal.gysaa-----------------------------