[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54084.1


[Show Plain Result]

## Summary of Sequence Search
   1::81
  14::83     2e-13 41.4% 0050264 00502641 1/1   like                                    
   1::81


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTNPDIVGSGQGNDSFEPVAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGAS
00502641   1/1  -------------lllkdleelsfeealeeLeeivekLesgdlsLeeslklyeeGvellklceelLeeae


                         -         -         *         -         -         -         -:140
query           ARVEQALNQAE-----------------------------------------------------------
00502641   1/1  qkvellleedgee---------------------------------------------------------