[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54269.1


[Show Plain Result]

## Summary of Sequence Search
   1::325
   5::319  2.2e-78 45.5% 0040865 00408651 1/1   ynthase (F1-ATPase), gamma subunit      
   2::318    1e-77 45.9% 0036816 00368161 1/1   ynthase (F1-ATPase), gamma subunit      
  19::279  1.7e-57 39.6% 0037751 00377511 1/1   ynthase (F1-ATPase), gamma subunit      
   1::325


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
00408651   1/1  ----keikrriksvkntqkitkamkmvaaaklrkaqeallalrpyaeelrkvlsnl.........lllee
00368161   1/1  -aslkeikrriksvkniqkitkamkmvaaaklrkaqerllaarpyaeklrkvlsnl.........lllee
00377511   1/1  ------------------KItkamkmvaasklrkaqerleaarpyaeklrevlsnlaselleilhpllea


                         -         -         *         -         -         -         -:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVLKKAAELEKLLAESGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
00408651   1/1  eevkkvllivitsdrGlcGgfnsnvlkaalkllkelkaegkevdliliGkkgidflkkrglniillllln
00368161   1/1  eevkkvllivitsdrGlcGgfnsnvlkaalkllkelkeegkevdliliGkkgidflkkrglnivllllln
00377511   1/1  revkkvllivitsdrGLcGgfNsnvikaalkllkelkaegkevdliliGkkgidflkrrglnillliigl


                         +         -         -         -         -         *         -:210
query           SQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISMLTQNPVVHQLLP
00408651   1/1  glsevptfadailialell..fll....................geydevylvynkfvsalsqeptvlql
00368161   1/1  glgevptfadallialell..fll....................geydevylvynkfvsalsqepvvlql
00377511   1/1  gdaptfeealliadellelfl....................ngeydevylvynkfvsalsqepvveqllP


                         -         -         -         +         -         -         -:280
query           VEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRRLFSIFLEAAAAESASRRNAMKS
00408651   1/1  lpldllelae................llylyepdaeellddllerylesllygalleslasElaaRmtaM
00368161   1/1  lpldllelee................llylyepdaeellddllerylesllygalleslasElaaRmtaM
00377511   1/1  ldvlklelaeklkll...........yeyepdaeevlddLlprylesllyralleslasElaaRmtAMk-


                         -         *         -         -         -         -         +:350
query           ATDNASELVKDLSRVANQARQAQITQEITEIVGGAGALADSGESD-------------------------
00408651   1/1  ksAtdnakelikkltllynraRQaaITqEllEIvsGaeA-------------------------------
00368161   1/1  ksAtdnakelikkltllynraRQaaITqEllEIvsGae--------------------------------
00377511   1/1  ----------------------------------------------------------------------