[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54313.1


[Show Plain Result]

## Summary of Sequence Search
   1::123
   1::123  1.1e-37 47.2% 0041841 00418411 1/1   e transport protein RbsD                
   1::123


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPEVVVEGAVIA
00418411   1/1  mlkggllnpellavlaelGHgdelviaDaglPipslakridlalllglpslldvlsllllellvekavla


                         -         -         *         -         -         -         -:140
query           EGTPERIREMVDTDVEVVTHEELKAQLAECAFVIRTGETTAYANVIFKSGVAF-----------------
00418411   1/1  eeikeanpellellkellseielelvereefyerakkakavvrtGeltpYani-----------------