[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54336.1


[Show Plain Result]

## Summary of Sequence Search
   1::391
  41::274  1.7e-37 30.9% 0051090 00510901 1/1   lasmic binding protein-like II          
  41::259  1.1e-17 26.6% 0049987 00499871 1/1   lasmic binding protein-like II          
  44::259  1.3e-14 23.8% 0052357 00523571 1/1   lasmic binding protein-like II          
  34::266  6.5e-09 23.2% 0051099 00510991 1/1   lasmic binding protein-like II          
  40::262  6.9e-09 21.5% 0038704 00387041 1/1   lasmic binding protein-like II          
  59::259  2.4e-08 18.8% 0046857 00468571 1/1   lasmic binding protein-like II          
  44::267  2.2e-07 21.1% 0042201 00422011 1/1   lasmic binding protein-like II          
  40::262  7.2e-06 19.1% 0040650 00406501 1/1   lasmic binding protein-like II          
  44::241  4.4e-05 20.2% 0050446 00504461 1/1   lasmic binding protein-like II          
  45::284  0.00043 19.4% 0051539 00515391 1/1   lasmic binding protein-like II          
  24::194  0.00078 30.1% 0043183 00431831 1/1   lasmic binding protein-like II          
   1::391


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTHTLFDSRRFLQLGAFASLSTALAGAARYVTSTSNNEPADNTPLTIGYVPIACSAPIAIANALGLFKKH
00510901   1/1  ----------------------------------------ekktlrigylpgpdaaplelak..glfkkl
00499871   1/1  ----------------------------------------ppktlrigtgspggtyyplgvalakglfke
00523571   1/1  -------------------------------------------tlrlgwspylndlplfvalekglfke.
00510991   1/1  ---------------------------------Llslaaiaaagtlrvgvs..pdypPfsyldedgkltG
00387041   1/1  ---------------------------------------kergtlrvgvdp..dypPfsyldedgklvGf
00468571   1/1  ----------------------------------------------------------gtlrvgvdlslp
00422011   1/1  -------------------------------------------tikvgatp..phaeil.evikkllkkk
00406501   1/1  ---------------------------------------kergtLrvgtdpd..ypPfsyldedgelvGf
00504461   1/1  -------------------------------------------tLrvgvd..pdypPfsfld.dgklvGf
00515391   1/1  --------------------------------------------tlrvGhspypndlplfyalaeglvdl
00431831   1/1  -----------------------lalag............dgktvrigyvnwtsatattavakl.llekl


                         -         -         *         -         -         -         -:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
00510901   1/1  GldvelveftdgaallealasGelDvalfgslpyllayak....glpvklvavlstygsa..lvvr.dsg
00499871   1/1  llglkvevvptggsvanlealaaGevDlalvgsdpallaqagtgpfegkgapldnlravaalypeplalv
00523571   1/1  gldveiv.fadpatlnellaagelDvavissaayllaadky....aplp.avaalgpgnsvlvvskkp..
00510991   1/1  fdvdlakalakrllgdpvkvefvpv.pwdrllealasgkvDlaiagltitperekg.........vdfsd
00387041   1/1  dvdlakalakrlgvkvefvpv.swdgllpalasgkvDla..iagltitp.......erakvvdfsapyyv
00468571   1/1  yvmllepfsyldgngkltGfdvdllralakrlglkvelvpvpdglygglnlengswdgllgalqsGeaDl
00422011   1/1  GidveivefsdysapneaLasGeiDanafqhlpyldafn....kenaglklvavgatyiaplglyskk..
00406501   1/1  dvdlakaiakrlgvkvefvpv.dwdrllpalqsgkvDli..iaglt.......itperekvvdfsdpyyt
00504461   1/1  dvdlakaiakrlglkvefvpv.dwdgllpalqsgkvDlaiagltit.........perekvvdfsdpyys
00515391   1/1  .gllfei.vledpetlnelllsgeldvaai....ssalyalladdyvllpvgailgrgygpsvvlksgvp
00431831   1/1  GykveltvfldyvvlyealanGdiDvgleawlpltdelyakavgdgkvvalganl..egakqglavpkyv


                         +         -         -         -         -         *         -:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
00510901   1/1  ikslaDLkdGkkvavpnggstsglll.allkkaGlikldplkdvklvnldpadavaalasgevDaavlwe
00499871   1/1  vrkdsgikslaDLkGKrvavgapGsgtellllalleaaGltp.ddvelvvnlgpadaaaaladgkvDAav
00523571   1/1  ...ledlkGkriavpggsttsalllrlllk........dvelvyvpfdeiiaallrgevdaglligdsal
00510991   1/1  pyytsglvlvvrkdspiksladLkgkrvgvvrgssyeelllell.........pdvklvevdspeealaa
00387041   1/1  sglvlvvrkdspliksladLkgkrvgvvkgstyelllkkllkkpgl..kivdyd....dpaealaaLaaG
00468571   1/1  a..agglti.......tperekvvdfsapylesglvllvrkdspllspiksledLkgkdglkvgvvrgss
00422011   1/1  .iksledLkdgkkiAipndpsnegralll.Lqkagliklkpgagllatvkdivenpkdlkiveldaaqlp
00406501   1/1  sglvlvvrkdspliksledLkgkrvgvvkgttyelllkkllkkpgl..kivlvd....dlaealqaLlaG
00504461   1/1  sglvlvvrkdnsgiksledLkgkrvgvvrgssteellkkll.........pdaklvlvdsleealaalls
00515391   1/1  .......lkgkkialpgrsttaalLlrlllp........daglvevpfpeippalllgevdaglligesa
00431831   1/1  adkpgiksiadLkgpkiallfdpeddfkgrilgiepGwgcealil.qalkaygl----------------


                         -         -         -         +         -         -         -:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQE
00510901   1/1  plddvdlavinanaaleaglrvladsldieggpslyvnvlvvrkd..dknpelvkallkallsp------
00499871   1/1  tvdpllaaaiaelaaggglrllpldddlldallealpyylpatipagty---------------------
00523571   1/1  taaerg....lvvvlDlgelweeltglplplgvlvarrdl...dpelva---------------------
00510991   1/1  LaaGrvDaavtdepvlayllkqlp.dlkvgvgeplsseplgiavrkgdpelldaln--------------
00387041   1/1  rvDaavadepvlayllkkgpllalavtsdlrvlglplspeplgiavrkg...------------------
00468571   1/1  teeyl.lelllelglllldkmipdvkvvevdspeealealasGrvdyaf---------------------
00422011   1/1  ral..gdvdaavinnnyalaagldplkdallledkdsillkpyinlivvrke..dkd-------------
00406501   1/1  rvDaavadspvlayllkklpllglllllglvvlgeplspeplgiavrkg...------------------
00504461   1/1  grvdavvadspvlayllkklplddlkvvgep---------------------------------------
00515391   1/1  ltyakagl.lvvldlgelWkeltglplPlgvlvvrrdlaeelaeeleealrk..sveyalenpeealeya
00431831   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KYLNQPAALLDGPFSGMYQDWHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGLGGDVLTMDDSTIINA
00510901   1/1  ----------------------------------------------------------------------
00499871   1/1  ----------------------------------------------------------------------
00523571   1/1  ----------------------------------------------------------------------
00510991   1/1  ----------------------------------------------------------------------
00387041   1/1  ----------------------------------------------------------------------
00468571   1/1  ----------------------------------------------------------------------
00422011   1/1  ----------------------------------------------------------------------
00406501   1/1  ----------------------------------------------------------------------
00504461   1/1  ----------------------------------------------------------------------
00515391   1/1  leya------------------------------------------------------------------
00431831   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AQSVLTPGLSVTGEHLNIISADFAPVTPTSGYEHMDSVIFR-----------------------------
00510901   1/1  ----------------------------------------------------------------------
00499871   1/1  ----------------------------------------------------------------------
00523571   1/1  ----------------------------------------------------------------------
00510991   1/1  ----------------------------------------------------------------------
00387041   1/1  ----------------------------------------------------------------------
00468571   1/1  ----------------------------------------------------------------------
00422011   1/1  ----------------------------------------------------------------------
00406501   1/1  ----------------------------------------------------------------------
00504461   1/1  ----------------------------------------------------------------------
00515391   1/1  ----------------------------------------------------------------------
00431831   1/1  ----------------------------------------------------------------------