[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54367.1


[Show Plain Result]

## Summary of Sequence Search
   1::185
   1::185  1.9e-58 50.6% 0052910 00529101 1/1   lycosyltransferase/glycogen phosphoryla 
   1::181  6.5e-56 52.0% 0051304 00513041 1/1   lycosyltransferase/glycogen phosphoryla 
   1::180  4.2e-48 45.1% 0046587 00465871 1/1   lycosyltransferase/glycogen phosphoryla 
   1::179  5.9e-45 40.2% 0048983 00489831 1/1   lycosyltransferase/glycogen phosphoryla 
   1::185


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYQ
00529101   1/1  ipaaDlseqiptaglEASGTsnmkfalNGaltlgtlDGanvEiyeevggengflfgltaeevlelrrdgy
00513041   1/1  ipgaDlslqiPtaglEAsGTsnMkaalnGaltlgtlDGanvEiveevGeengflfGltaeevlelr.dyd
00465871   1/1  yagaDlslqiPsrgfEpsGtsqmkamlnGalplvtldGglvetvedvgeengflFgldaeevedllaaly
00489831   1/1  yagaDlslqiPsrgfEpsGlsqmkamlnGtlpivtldGglvetvedvgengffifgftfeevedllaaly


                         -         -         *         -         -         -         -:140
query           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
00529101   1/1  dardlyelleelkevldllasglfspgdpelfkelvpllldr......dlylvladfesYleaqekvdel
00513041   1/1  aldlyeadpllkllldlilpgffsrgedglfrdlvdslln.....andiylvladFssyrmvqeyvdelY
00465871   1/1  ralalyelleelkevvdlamsgdfswddsalyldlydsllkn......diylvladFssyrmvqeyvdel
00489831   1/1  raldlyelleelkevvdlamsgdfswldselylelynsllslap....dfyrvladyelYleaqekvdal


                         +         -         -         -         -         *         -:210
query           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPTPAVKK-------------------------
00529101   1/1  yg.dpeeWlkmailnialagkFssdRtireYaediwllepvklel-------------------------
00513041   1/1  ldaleewlrlsilniaragkfssdrtireyaeeiWnlepve-----------------------------
00465871   1/1  Yl.daaewlrkailniarsgkFssdrtiaeyaediwnlep------------------------------
00489831   1/1  yr.dqlaWtkksilniarvglfssdrtireyaediwgve-------------------------------