[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54563.1


[Show Plain Result]

## Summary of Sequence Search
   1::140
   1::136  3.4e-26 29.5% 0042188 00421881 1/1   hotyrosine protein phosphatases I       
   3::135  8.4e-25 34.9% 0047572 00475721 1/1   hotyrosine protein phosphatases I       
   4::137  2.5e-24 33.1% 0047618 00476181 1/1   hotyrosine protein phosphatases I       
   6::135  5.8e-24 34.7% 0051181 00511811 1/1   hotyrosine protein phosphatases I       
   3::137  6.4e-21 29.8% 0048765 00487651 1/1   hotyrosine protein phosphatases I       
   1::137    7e-21 28.6% 0053360 00533601 1/1   hotyrosine protein phosphatases I       
   1::137    2e-16 27.1% 0046251 00462511 1/1   hotyrosine protein phosphatases I       
   1::140


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDQPSVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGID
00421881   1/1  lskkkkvlfvCtgNicRSpmAeallrhllgdrvevdSAGtsayhvgepvdpravevlaelgidisghrar
00475721   1/1  --kkkkvlfvCtgNscRSpmAeallrhllgdrvevySAGtegsg.vdpravevlaelgidisghrskqld
00476181   1/1  ---kkkvlfvCtgNicRSpmAeallrhllgdrvevdSAGtepag.vdpravevlaelgidisghrskqld
00511811   1/1  -----kvlfvCtgNicRSpmAeallrhllgd.vevdSAGthpggpvdpravevlaelgidls.lrskqld
00487651   1/1  --mmkkvLfvCtgNicRSpmAeallrhlleeaglgdrvevdSaGtsayhvgepvdpravevlaelgidls
00533601   1/1  llskmkkvLfvCtgNicRSpmAeallrhlleeaglgdrfevdSaGtsalhvggpvdpravevlaelgidl
00462511   1/1  lllmkkkvlfvCtgNicRSpmAeallrhlledaglsdllievdSaGtsalhvgeppdpravavlkelgid


                         -         -         *         -         -         -         -:140
query           LDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRLVRDDIDARVQNLIAELTQNA
00421881   1/1  qlteedleefDlvltmddsnlrdllplfpgaakgkvllllefwdvpDPyygg.e...afeevldli----
00475721   1/1  elllpefdlvitmddsalealpllapaalrlhwdipDPyggg...leafrevrdlierrvlalle-----
00476181   1/1  eldlpefdlvltmddsalealpllapaalrlhwdvpDPyygggteeekleafervldlieerveall---
00511811   1/1  eldleefdlvltmdds.nlcpllplaplllhwdvpDPyygglee...feevldlieerveallek-----
00487651   1/1  .hrarqlteedleefdliltmddsnleellplfpglleakgkvllllefagllhwdvpDPyyggle.---
00533601   1/1  s.hrarqlteedleefdliltmddsnleellplfpglleakgkvllllefagllhwdvpDPyyggle---
00462511   1/1  ls.hrarqlteedfeefdlilamddsnlrdllrlapgdargkvllllefagllellhwdvpDPyygg---