[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54635.1


[Show Plain Result]

## Summary of Sequence Search
   1::422
   3::212  4.4e-86 62.0% 0037940 00379401 1/1   RibB                                    
  11::215  5.3e-86 62.4% 0039907 00399071 1/1   RibB                                    
   9::210  7.2e-79 65.2% 0044038 00440381 1/1   RibB                                    
  12::208  3.4e-78 64.1% 0042499 00424991 1/1   RibB                                    
 213::389    2e-62 63.8% 0052081 00520811 1/1   like                                    
   1::422


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSEHEQAHSQLDSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELATPELVAFMVRYSSGYICAPLTA
00379401   1/1  --llellglllssieeaiealraGklvlvvddedrenegdlvlaaelvtpelinfmirhasGliclalte
00399071   1/1  ----------llsieeaiealraGklvlvvddedrenegdlvlaAelvtpelinfmarhasGliclalte
00440381   1/1  --------llllsieeaiealraGklvlvvddedrenegdlvlaaelvtpelinflvrlasGliclalte
00424991   1/1  -----------lsieeaiealraGklvlvvddedrenegdlviaAelvtpelinflvrhasGliclalte
00520811   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAR
00379401   1/1  elaerlgLplmvedntsdlgtaftvsvdaaegvtTGisaadraltiraladpdakpedlvrPGHvfplra
00399071   1/1  elakrlgLplmvdlndssygtaftvsidaaelgvtTGisaadRaltiraladpdakpedlvrPGHvfplr
00440381   1/1  eraerlgLplmvednsddlgtaftvsvdaalgvtTGisaadRaltirlladpnakpedlvrPGHvfplra
00424991   1/1  eraeklgLplmvdlnteasellelleelleddleddlgtaftvsvdargvtTGisaadRaltiraladlv
00520811   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRK
00379401   1/1  keggvleRaGhtEaavdLarlaGlkpaavicellnd..dgtmarlpellefaeehglklitiedlieyrl
00399071   1/1  ardggvleRaGhtEaavdLarlaglkpaaviceilnddeeaegealeedgtmarldellefaeehglkli
00440381   1/1  rdggvleRaGhteaavdLarlaglkpaavicellneddgt.marldellefaeehglklitiedlieyrl
00424991   1/1  eeeeldalpedfvrPGHvfplrardggvleRaGhteaavdLarlagllpaavicelln..ddgsmarl--
00520811   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NEILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCD
00379401   1/1  kl--------------------------------------------------------------------
00399071   1/1  tiedl-----------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  --slvervaeaelptlfgefrlvayrdlidglehlalvkGdi..dddepvlvRvhsecltgDvlgslrcd


                         -         *         -         -         -         -         +:350
query           CGQQLHESLRLIQEAGRGVVVYMRGHEGRGIGLLAKLRAYQLQDEGADTVDANLALGLPADAREFGTSAQ
00379401   1/1  ----------------------------------------------------------------------
00399071   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  cgwqLeaaleliaeegrGvlvylr.qegrgigllnklrayalqdegldtveanealgfpadlrdyglgaq


                         -         -         -         -         *         -         -:420
query           ILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIPVAVHEDNVRYLKTKRDRMGHDLPDVALWEQEHP
00379401   1/1  ----------------------------------------------------------------------
00399071   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  iLrdlgvskirlltnnprklvgLegfglevvervpllve-------------------------------


                         -         -         +         -         -         -         -:490
query           EN--------------------------------------------------------------------
00379401   1/1  ----------------------------------------------------------------------
00399071   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  ----------------------------------------------------------------------