[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54728.1


[Show Plain Result]

## Summary of Sequence Search
   1::149
   7::148  2.1e-47 51.8% 0049218 00492181 1/1   se-like                                 
   1::146  2.5e-46 51.5% 0050315 00503151 1/1   se-like                                 
   5::143  4.7e-46 50.4% 0042623 00426231 1/1   se-like                                 
   7::146  9.1e-43 47.9% 0049409 00494091 1/1   se-like                                 
  12::146  2.4e-37 51.9% 0037428 00374281 1/1   se-like                                 
  16::147  5.6e-37 52.5% 0052042 00520421 1/1   se-like                                 
   7::126  9.5e-36 49.6% 0052041 00520411 1/1   se-like                                 
  11::134  4.8e-35 49.2% 0036608 00366081 1/1   se-like                                 
   5::146  6.2e-34 48.5% 0051089 00510891 1/1   se-like                                 
   1::127  2.3e-32 42.3% 0041842 00418421 1/1   se-like                                 
   1::149


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
00492181   1/1  ------lmllsdleilvlllsgglllptratlgsagyDLraaedepvvlppgetalvptglaielpdkgl
00503151   1/1  mllsdkiivkrlsegallplratlgsagyDLrlaedvvikpgetalvptglaielllegdlfillpgsfv
00426231   1/1  ----mlmlidleilvkllsegallptratagsagydLraaedivlpPgetalvptglaialppgyaglll
00494091   1/1  ------iqpasldlrlgnellvfklgdgailpkratagsagldlraaedvvlpPgetalvptgeaialpe
00374281   1/1  -----------llenallplratlgsagydLraaedivlpPgetvlvptglaialppgyaglllgrssla
00520421   1/1  ---------------lelplyatpgdAglDLrapedivlpPgetvlvptglaialppgyaalilgRSsla
00520411   1/1  ------llvkllldnallplyatagdagldLraaedivlpPgetalvptglaialppgyaalllgrSgla
00366081   1/1  ----------rlsenaelpsyatlgsagyDLraaedvvlppgetalvptglaialppgyaglilgrSsla
00510891   1/1  ----laiidlklldelllplyategsagldllldegfvlePgevylvptgeaialPeglaalvlpRSsla
00418421   1/1  M.ilsdkeikklllkgalvieppveatigsaGyDLrlaneflvfrnsvlgvidlknadrllieellllls


                         -         -         *         -         -         -         -:140
query           AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKVELVDFEEVEELDDTVRGDQ
00492181   1/1  aglilpRSglarkglivllntagviDpdYrgeikvilfnlgde.pvtikkgdriaQlvflpvltaeleev
00503151   1/1  lavtlelvklpegyvalilpRSsla.klgltvlntagviDagYrGeitvllynlgd.epvtikkgdriaQ
00426231   1/1  grsslalklglt..vlagvidpgyrgeiklilfnlgd.lpvtikkgdriaqlvflplltpeleeveelsg
00494091   1/1  glvglilpRSslarkglivllntagvidpgYrgeitlllfnlgdelpvtikkgdriaqlvflpllgpale
00374281   1/1  rk.gllvl..pgvidpgyrgeitvllfnlgd.lpvtikkgdriaqlvflpllspeleevselsesergdg
00520421   1/1  lkgli......glidpgyrGeiklillNls.kepvtlkkgdriaqlvllp.....lelvellpdterggg
00520411   1/1  lk.gl.....vgvidsgyrGeikvillnlg.depvtikkgdriaqlvllpvvtpel--------------
00366081   1/1  rk.g..llvlagvidpgYrgeitvilfnlgd.lpvtikkgdriaqlvflpvltpeleevselge------
00510891   1/1  .rlgllvlntagviDpgyrgeitlelvnlgk.lpfrlypgeriaQlvfepv....lgpveelygterggk
00418421   1/1  aelnlellelleidldedlvLpPgefylvptgeaielPedvaalilpRSsla.rlgi-------------


                         +         -         -         -         -         *         -:210
query           GYGSTGKTA-------------------------------------------------------------
00492181   1/1  delseter--------------------------------------------------------------
00503151   1/1  lvflpv----------------------------------------------------------------
00426231   1/1  tyr-------------------------------------------------------------------
00494091   1/1  eydgly----------------------------------------------------------------
00374281   1/1  gfGstG----------------------------------------------------------------
00520421   1/1  gfgstgv---------------------------------------------------------------
00520411   1/1  ----------------------------------------------------------------------
00366081   1/1  ----------------------------------------------------------------------
00510891   1/1  yfgstg----------------------------------------------------------------
00418421   1/1  ----------------------------------------------------------------------