[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54831.1


[Show Plain Result]

## Summary of Sequence Search
   1::622
 308::614  2.6e-60 31.9% 0050287 00502871 1/1   lactamase/transpeptidase-like           
 307::608  6.7e-57 31.4% 0048985 00489851 1/1   lactamase/transpeptidase-like           
 277::605  1.3e-53 30.1% 0052119 00521191 1/1   lactamase/transpeptidase-like           
 307::598  3.5e-52 33.1% 0047727 00477271 1/1   lactamase/transpeptidase-like           
 307::605  1.4e-49 32.7% 0049225 00492251 1/1   lactamase/transpeptidase-like           
 176::607  4.2e-40 26.2% 0051964 00519641 1/1   lactamase/transpeptidase-like           
 302::609  1.4e-37 29.0% 0048511 00485111 1/1   lactamase/transpeptidase-like           
 309::606    3e-37 28.9% 0046014 00460141 1/1   lactamase/transpeptidase-like           
 320::605  4.4e-37 29.3% 0046452 00464521 1/1   lactamase/transpeptidase-like           
 307::605  1.6e-36 27.5% 0046929 00469291 1/1   lactamase/transpeptidase-like           
 306::608  3.6e-35 27.9% 0050891 00508911 1/1   lactamase/transpeptidase-like           
 310::607  3.5e-34 29.3% 0052144 00521441 1/1   lactamase/transpeptidase-like           
 310::603  5.5e-34 28.9% 0046008 00460081 1/1   lactamase/transpeptidase-like           
 309::604  5.8e-34 30.3% 0048110 00481101 1/1   lactamase/transpeptidase-like           
 306::606  1.3e-33 28.2% 0048423 00484231 1/1   lactamase/transpeptidase-like           
 310::606  2.5e-33 28.7% 0053342 00533421 1/1   lactamase/transpeptidase-like           
 309::605  1.2e-32 28.3% 0046438 00464381 1/1   lactamase/transpeptidase-like           
 310::611  1.4e-32 26.1% 0047733 00477331 1/1   lactamase/transpeptidase-like           
 309::606  1.1e-31 27.2% 0048305 00483051 1/1   lactamase/transpeptidase-like           
 307::606  1.4e-31 27.5% 0046422 00464221 1/1   lactamase/transpeptidase-like           
 329::575  1.5e-31 29.7% 0045791 00457911 1/1   lactamase/transpeptidase-like           
 328::605  2.6e-18 24.3% 0051055 00510551 1/1   lactamase/transpeptidase-like           
 312::602  4.2e-16 25.2% 0046343 00463431 1/1   lactamase/transpeptidase-like           
 306::598    5e-16 25.7% 0047476 00474761 1/1   lactamase/transpeptidase-like           
 330::601  5.3e-14 24.1% 0046615 00466151 1/1   lactamase/transpeptidase-like           
 310::602  9.6e-14 22.6% 0038811 00388111 1/1   lactamase/transpeptidase-like           
  34::138    1e-07 20.2% 0050285 00502851 1/1   like                                    
 139::307  1.7e-07 20.0% 0050286 00502861 1/1   illin binding protein dimerisation doma 
 311::609  9.4e-07 23.9% 0047175 00471751 1/1   lactamase/transpeptidase-like           
   1::622


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKVQRRSLMALCMTVAFAGGSLTACTPRPDTADPIAEEFLQAWASQDFDTIADITDQADLATEMLSTSF
00502871   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00519641   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00502851   1/1  ---------------------------------ektleeyikalekkdyekmyellseeskkdiskeefi
00502861   1/1  ----------------------------------------------------------------------
00471751   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DGLQADSVELTLDSVDSRDTIATANFSVVWKLPRDREVSYDSSMTLTKMRNEWTVRWEPSLVHPKLGANQ
00502871   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00519641   1/1  ----------------------------------------------------------------------
00485111   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00502851   1/1  eryekiYegigvkdlkvsilkvkkdednkatltykvsmdtlaGkl.efsneatlvkedddwkidWdps--
00502861   1/1  --------------------------------------------------------------------en
00471751   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDADVVVKRVADYLNEAHATDENVNTLDVEDIM
00502871   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00521191   1/1  ----------------------------------------------------------------------
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00519641   1/1  -----------------------------------PlrnperaleRrnlvLdrmvelg............
00485111   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  rirvvtipapRGlIlDrngvlLAtnvpvysvvvipsllkd.evakkLakll........gldeeellkkl
00471751   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SNLGDSTYSLTTVDANLGARMEQDLAGIPGLTFNEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRA
00502871   1/1  ----------------------------------------------------------------------
00489851   1/1  ----------------------------------------------------------------------
00521191   1/1  ------------------------------------------------------------------gkap
00477271   1/1  ----------------------------------------------------------------------
00492251   1/1  ----------------------------------------------------------------------
00519641   1/1  ......................................................................
00485111   1/1  ----------------------------------------------------------------------
00460141   1/1  ----------------------------------------------------------------------
00464521   1/1  ----------------------------------------------------------------------
00469291   1/1  ----------------------------------------------------------------------
00508911   1/1  ----------------------------------------------------------------------
00521441   1/1  ----------------------------------------------------------------------
00460081   1/1  ----------------------------------------------------------------------
00481101   1/1  ----------------------------------------------------------------------
00484231   1/1  ----------------------------------------------------------------------
00533421   1/1  ----------------------------------------------------------------------
00464381   1/1  ----------------------------------------------------------------------
00477331   1/1  ----------------------------------------------------------------------
00483051   1/1  ----------------------------------------------------------------------
00464221   1/1  ----------------------------------------------------------------------
00457911   1/1  ----------------------------------------------------------------------
00510551   1/1  ----------------------------------------------------------------------
00463431   1/1  ----------------------------------------------------------------------
00474761   1/1  ----------------------------------------------------------------------
00466151   1/1  ----------------------------------------------------------------------
00388111   1/1  ----------------------------------------------------------------------
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  kkkrvlfvvlardlsleeaarikelllklpgvlieeelkRyYpygelaahvlGyvglineeelekleakg
00471751   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SIVTSNGAVIDDIAYDAPELAPSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEAD
00502871   1/1  ---------------------------lDldlQkaaeealkd...kqgavvvldpkTGeilAmvsgpsyd
00489851   1/1  --------------------------TldldlQkaaeealkkalellgalqgaavvldpktGevlAmvgg
00521191   1/1  yfvdavgrelrellgllleevlptggldiyltldldlQkaaeealrkallaldklgalqgavvvldpktG
00477271   1/1  --------------------------TldldlQkaaeealdkalellgalqgaavvldpktGevlAmvgg
00492251   1/1  --------------------------TldldlQkaaeealdkalellgalqgavvvldpktGevlAmvss
00519641   1/1  ......pyfadlvrkellellgldlalellytgglkiyttlDldlQkaaeealknallaldkklgalqga
00485111   1/1  ---------------------edlvltldaklqalaeel.....gargavvvidpktGevla........
00460141   1/1  ----------------------------dlelqkaleallke.pgasgaavvidpktGevla........
00464521   1/1  ---------------------------------------lalkaalgal.vvldpktGravlalvgtgdy
00469291   1/1  --------------------------sldaklqkaleallk.elgasgavvvidpktGevla........
00508911   1/1  -------------------------dldlqltldaalqkalealpgvsgaavvldpktGevlal......
00521441   1/1  -----------------------------adlqkaleallkep.gasgaavvidlktGevla........
00460081   1/1  -----------------------------sdlqdaldallk.elgasgaavvidlktgellarn......
00481101   1/1  ----------------------------daelqkaalellp...glsgaavvldpktGevlalvggp...
00484231   1/1  -------------------------llllllllleelaallkepdargaavvldpktGevlal.......
00533421   1/1  -----------------------------eklaallke.....lgasgaavvldlktgevla........
00464381   1/1  ----------------------------seklqqaleallkd.lgapgaavvvdvktGevla........
00477331   1/1  -----------------------------tlledalakllkal.gargaavvldpktGevlalvggpdy.
00483051   1/1  ----------------------------dpklqkaleallke.lgargaavvidpktGevla........
00464221   1/1  --------------------------dlqsalddalqkllke.pgargavvvidpktGevla........
00457911   1/1  ------------------------------------------------llglllllllllllllllllll
00510551   1/1  -----------------------------------------------fdagaggavvldlktGevlaakn
00463431   1/1  -------------------------------eekleelekel..ggrlgvividldtgevlsynader..
00474761   1/1  -------------------------lsLeqllealekel.....ggrlgvvvidldtgevlaknade...
00466151   1/1  -------------------------------------------------dpdvgavgaivldldtgevla
00388111   1/1  -----------------------------seleevlaallkklgg.rlgvavldldtgevlalna.....
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  yslgdliGksGlEkayedlLrGkdgkr-------------------------------------------
00471751   1/1  ------------------------------lllaalaallpelgar...gavvldldtgevla.......


                         -         -         -         -         *         -         -:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
00502871   1/1  pnlfvggissalylallndlakpllnrat.glyepGStfKpltaaaaleegvitpnttlddpglllvggr
00489851   1/1  pdydpnlfvggidlkpllnravqalrqpGStfKpftyaaaLeegvitpnttl.ddgpltlggrtirdwdp
00521191   1/1  evlAmvggpdydpnlfvgfnravqalrqpGStfKpftaYaaaLeegliltpdtlldd.gpltlggglytp
00477271   1/1  pdydpnlfvggissaplfnravqalrqpGStfKpftyaaaLeeglitpdtll.ddgpitiggwtprnydg
00492251   1/1  psydpnlfggrdpdkplfnratqalrqpGStfKpftyaaaLeegvitpdttl.ddgpltlggrtirnwdp
00519641   1/1  lvvldpktGevlAmvggpdydpngfnravqalrqpGStfKPfvvyaaALeeglitpatllddapiti.gg
00485111   1/1  fnpdtr....fppaSttKlftaaaalelveeGklslddpvtdspsaylpgfp..nadlrvggsitlrdll
00460141   1/1  ....rnadtrfppaSttKlftalaalqlveegklslddpvtdslpalvgg..psnydlkvggsitlrdll
00464521   1/1  vlnefnradq.rfppgStfKpftalaaLeagklsldttvtdspla...sytplnwg....gtvtlreala
00469291   1/1  ....rnadtrfppaSttKlftalaalqlveeGklslddpvtdsppalklggsnvdlrv...ggsitlrdl
00508911   1/1  ..llnra.darfppgStfKpftalaaleegklsldtlvtdspla...sytplnwg....gtvtlrealav
00521441   1/1  ynpdt....rfppaStfKlftaaaalqlveegklslddtvtdsgpalvgggsirplnvggsitlrellrh
00460081   1/1  ......adtrfppaSttKlftalaalqlveleGkllddpvtvsgldllgagylpgsnvglagggsitlrd
00481101   1/1  .....aadarfppgStfKpftaaaaLeagklslddlvtdspl....glrpgnwd....gvvdllealavS
00484231   1/1  ...nravadarrppgStfKpftalaaLeegkisldtlvtdsplalvgggpi.......lgdltlrealaq
00533421   1/1  ....rnadarfppaStfKlftalaaleeegklslddtvtvsgpalvlggsitplnvgesitlrellraal
00464381   1/1  ynpdt....lfppaSttKlftalaalqlveeGklslddpvtdsplalvggkylppsnldlagggsitlrd
00477331   1/1  ......adarfppgStfKpftalaaleegklsldtlvtdspla...gysplnwg....gtvtlrealayS
00483051   1/1  ...nrnadtrfppaSttKlftaaaalqlveeGklslddpvtdsppalvggsp..nydlkpggsitlrdll
00464221   1/1  ....rnadtrfppaSttKlftalaalelveeGklslddpvtdslpalvggspkn.dlrvg.gsitlrdll
00457911   1/1  lllllmkklllllllllllladalaallkelgakggavvidlktGellaknad............trfpp
00510551   1/1  ad...........tlfppaSttKlftalaalqlveeGklslddpvtvskylpefgggsgitirlllghts
00463431   1/1  ..........fppAStfKlltalavleavdegk.ldekvtitkedlvagspvlellv..ggsltlrelle
00474761   1/1  .........rfppAStfKlltaaavleavdegklslddrvtiskedlvlgspvlellv..ggtltlrell
00466151   1/1  ...........sknaderfppASttKlmtaaaaleegklslddpvtvtellsdlapgspgskvflpag.g
00388111   1/1  .......derfppaSttKlltaaavleavdegklslddkvtitesdlvpgspvtell..pgegitlrell
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  ----------------------------------------------------------------------
00471751   1/1  ....sknadtrfppASttKlmtalavlelveegklslddpvtvslpalvlgsvlll..pgslaflpagds


                         -         -         +         -         -         -         -:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
00502871   1/1  tirnwdvtelggghgtvtlrealavSsNvyfvklalklgldklvdylkkfglgektgidlpgeasgllpd
00489851   1/1  nydggghgpvtlrealakSsNvafvklalklgldklvdylrkfglgsktgidlpgeasgllplddw.gdl
00521191   1/1  rnwdggghgpvtlrealakSsNvpfvrlalklgldkladylrrfGlglktgidlpgea............
00477271   1/1  kgllllhgpvtlrealakSsNvafvklalklgpdklvdylrrfglglktgidlpgeasgllpswspl.dl
00492251   1/1  nydgrghgpvtlrealakSsNvyfvrlalklgldklvdylrrfglglktgidlpgeasgllpsddw.vdl
00519641   1/1  wtprnyldgkyhgpvtlreALakSlNvpavrlllelgddldkvvdylkklGlgsplgigl..........
00485111   1/1  thalglSsNtaavllaellggadavneilkplGlgnttfvdlpgelnglglg.............gggll
00460141   1/1  thalglSdNdaavllaerlaggadamneilkplGlgnttfvdlpgelngsgllgeg.............l
00464521   1/1  vSsNtaavalaerlGvdamndyarklGlg.ntdlpg................llslglggggltvTpldl
00469291   1/1  lthalgySdndaavllaerlgGpeslaeflrklgfgp.tglgmtntlflnasgl............gggl
00508911   1/1  SsNtaavalaerlGvdamneyarklGlgnttf..................dlnslglgqgsltvtpldla
00521441   1/1  alalSsNtaavllaerlgGadamneyakklGlgnttfidlpgelnglgllsre.............nltT
00460081   1/1  llthalglSdNtaavalaerlgGpealaaflrrlglgakplgmlpyeflgasglgri.............
00481101   1/1  sNtaavalaerlGvdamneyarklGlgnttfinlpgeapgl.................nlaiglgsltvt
00484231   1/1  SsNtaavalaerlGvdkmneyakklGlg.ntdlpgnlsg.................llgggltttpldla
00533421   1/1  aySdNtaavalaerlgGadamneyarklGlgnttfgldlpgensggllsre..............nlsTp
00464381   1/1  llthalglSdNdaavalaerlgGpealaeflrrlglgapllglpgttfynssgl..............gg
00477331   1/1  sNtaavalaerlGvdamneyarklGlgn.tdlpgenpg................glggggltvtpldlar
00483051   1/1  thalgySdNtaavllaerlgGleafaeylnelgfgp.tglgltdttfgnasglder............ll
00464221   1/1  thalglSdNtaavalaerlaggpdavneparrlgys.ntgfdllglalgnvsglslg............l
00457911   1/1  aStfKlftalaalelveeGk.lddtvtdspgalvlggp...nvdlrgggsitlrelltaalaySdNtaav
00510551   1/1  glrdllrgalvySdNtaavllaellggsgksfaeamnerlrelGmtnttfvnp.................
00463431   1/1  aallySdNtaanlLaerlgGvdamnayakelGlkntrldnpegllnealp.............gdgrntt
00474761   1/1  eaallySdNtaanaLaerlgGpdavnafarelGl..................tdtrldrpegllnealpg
00466151   1/1  svtlrdlltaallySdNdaanlLaellgagseeavtglsfaeamndiakrlglt.nttfvnpsglp....
00388111   1/1  eaalvySdNtaanlLaerlgGveavneyakslGlkntrldrlepelnaagl.............gdggnt
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  ----------------------------------------------------------------------
00471751   1/1  itlrdlltamlvySdNdaanlLaerlggsleafadamndiakplgmt.nttfvnpsgl............


                         *         -         -         -         -         +         -:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
00502871   1/1  klwsegdlatlsigqgtllvtplqlaqayaalangGvlvkPhlvkkivdpdgn.krviseetadlvrdml
00489851   1/1  aslalGqg.levtplqlaqayaalangGvlvkphlikkivdadgkvlyeakpevlerv..lspetaalvr
00521191   1/1  ..llslalGqg.levtplqlaqayaalangGvlvkphlikkivdadgkvleakpvgervlspetaalvrd
00477271   1/1  lslalGqg.levtplqlaqayaaiangGvlvkphlikkivdadgkvlyeakpevlerv..lspetaalvr
00492251   1/1  lslalGqg.lsvtplqlaqayaalangGvlvkphlikkivdadgevlyelkpevlerv..lspetaalvr
00519641   1/1  .........slailgg.vevtplqlanayatlangGvyvkpylikkivdsdgkvlyefkpkvvrvispet
00485111   1/1  sTpldlarllaalang...................rvlspetaallldlllpvvvgdgtgrlllppgvdv
00460141   1/1  lsTpldlarllaalang...................rllspetaellldllrgvvtngtgllaglpegvd
00464521   1/1  arlyaalanggllvspllikkildalgrvl............................ppgydvagKTGt
00469291   1/1  lsTpldlarllaalang...................rllspetaalllslligvvtggtgnrallpaggr
00508911   1/1  rlyaalanggllvkpsliklitdldgnv...........................lppgydvagKTGttq
00521441   1/1  pldlarllaal..................lkg.pvlspetaellldllrgvvtngtglllpl.ggrvagK
00460081   1/1  llsTaldlarllaalang...................rllspetaallldllrgvvtggtglrlllpdgg
00481101   1/1  pldlarlyaalanggllvkpylikk..........................ivdanglvllppgydvagK
00484231   1/1  layaalanggllvkpylikkildlngnvlln............................gyvvagKTGtt
00533421   1/1  ldlarllaalang...................rvlspetaallldllrgvvtggtgnrallpaggvvagK
00464381   1/1  gllsTaldlarllaalang...................rllspetaalllsllrgvvtygtgnrlllpag
00477331   1/1  ayaalangglllepyliklitdldgnvll............................pgyvvagKTGttn
00483051   1/1  sTpldlarllaalang...................rllspetaallldllrgvvtygtgnrallpaggpv
00464221   1/1  lsTpldlarllaalang...................rvlspetaallldllrgvvtygtgnrlllppggp
00457911   1/1  aLaerlgGvdamneyarrlGlgnttfvnlpgelsglapgdeg...............lttTpldlarlla
00510551   1/1  ..sGldrklwepellaalsgggglysTardlarllrallngg..................pllspetaal
00463431   1/1  tprdlakllrallngg...................llspesrsllldllkgnvtggnrlraglpkggvvg
00474761   1/1  dgrnttTprdlalllaallngp...................llseisrallldllkgnvtggnrlrallp
00466151   1/1  ..............dggntsTardlarllrallnggllpeilrtllltllvantt..........gdlle
00388111   1/1  tTprdlarllrallng...................dllspesraqlldllkgnvtgdnrlraglpygwvv
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  ----------------------------------------------------------------------
00471751   1/1  ......gdggntsTardlarllrallnggpllsplssallltll....................ggtltg


                         -         -         -         *         -         -         -:630
query           NEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAVTDQFFVKLDELRAGGEVAVSEAEEQPVG--------
00502871   1/1  rgvvtsGtgraaavpgypvaGKTGTaevvvlggyngrydawfvGyap.dnpkya----------------
00489851   1/1  dmlrgvvngslslelltggtgrrlalvlgypvagKTGTaqvvdlglgg----------------------
00521191   1/1  mlrgvvtsGtgrraalpgypvagKTGTaqvvllggggklllselg-------------------------
00477271   1/1  dmlrgvvtgsllllllsgGtgrrlaavlgypvagKTGT--------------------------------
00492251   1/1  dmlrgvvtsgrllllllsGtgrrlaavlgypvagKTGTaqvvdlv-------------------------
00519641   1/1  aylvtdmLrgvvesgtgrrarslllllsllllgypvagKTGTtn..d-----------------------
00485111   1/1  agKtGttnlggrslvgfapdladgprlavvvlgndpgagaaaraaiaap---------------------
00460141   1/1  vagKTGttqvag..vawfvgyapapdgprlivvvlvddpgggratg------------------------
00464521   1/1  tqvgyagdaadawfvgyapadgprlvvavlvgnpdgsggavaapi-------------------------
00469291   1/1  vagKtGttlnggrslvgfapradgpviavvvgvddpgaraaeaak-------------------------
00508911   1/1  vagdnylawfvgyapaddprlvvavlvgnddtggsvaapiareileal----------------------
00521441   1/1  TGt..tlrg.gawfvgyapdadgprlvvvvlvggpsggaggsvaapl-----------------------
00460081   1/1  rvagKTGttqv...ggawfvgyapaddgrrlvvvvlgndpgag---------------------------
00481101   1/1  TGttqgagdnryhawfvgyalpadgprvvvvvlvdnpggdrltg--------------------------
00484231   1/1  qvagdgyhawfvgfapadnprlvvavlvgnddltggsvaapiakei------------------------
00533421   1/1  TGttnvg...gawfvgyapladgprlivvvlvddpgggraaaapva------------------------
00464381   1/1  grvagKtGttqvvlGlagvawfvgyappadgprlavvvlvndpgp-------------------------
00477331   1/1  g....agwfvgyaptdgprlavavlvddpgplrggsvaapiareileallk-------------------
00483051   1/1  agKtGttneggrslvgfapadggrviavvvgvndpggraaeaakla------------------------
00464221   1/1  vagKtGttnda..gdawfvgyalpadgprlavvvlvndpgggrata------------------------
00457911   1/1  alanggll.......-------------------------------------------------------
00510551   1/1  lltlll.vvlygtgrlllraglpldgvvggKtGttggagadfvgv-------------------------
00463431   1/1  gKtGttdaagvrndaalvgtpnrdgpyviavllngldkdaea----------------------------
00474761   1/1  agwvvggKTGttdyagrndvgivtlpggrlivvvvltd--------------------------------
00466151   1/1  lvvraglnrlllpyggvvggKtGtt...dgagndlaivapp-----------------------------
00388111   1/1  ggKtGttd...yggrndvgivwppngrplivvvltngpdnda----------------------------
00502851   1/1  ----------------------------------------------------------------------
00502861   1/1  ----------------------------------------------------------------------
00471751   1/1  tnrllaglpagvvggKtGttd...gagndlgivatrdgrrlivvvlgnd---------------------