[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF54857.1


[Show Plain Result]

## Summary of Sequence Search
   1::314
  52::312  1.3e-48 29.9% 0036959 00369591 1/1   cal backbone" metal receptor            
  56::298    9e-40 26.3% 0052172 00521721 1/1   cal backbone" metal receptor            
  54::312  1.6e-35 27.2% 0048271 00482711 1/1   cal backbone" metal receptor            
  56::312    1e-30 23.9% 0052519 00525191 1/1   cal backbone" metal receptor            
   1::314


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQMKISRRAFLGTLLGATTLAVAACAQSSQNQNSSASSSSSSSAESSTSPSSSDEQRIVALNTGQLDNLL
00369591   1/1  ---------------------------------------------------panPkRvValdpaatetll
00521721   1/1  -------------------------------------------------------lllaasaaatvttvd
00482711   1/1  -----------------------------------------------------PPeRivslspsltelll
00525191   1/1  -------------------------------------------------------eRivslspaatelll


                         -         -         *         -         -         -         -:140
query           LLGITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
00369591   1/1  aLGvkpvGvadtslypilvylppal.......kklpdvgslsepnlEaiaalkPDlila.sgrseelydq
00521721   1/1  haggevtipkppeRiVsldpsatetllaLgvepvgvgvtsf.........sdyllppalkdlpvvgslre
00482711   1/1  aLglglvGvsdy...sdyp..........pelkklpvvgsllepnlEailalkPDlvlaslsggpeelle
00525191   1/1  algagdkvvGvsdssd...kvplllplvllppelagiptvgslydlgepdlEallalkPDliiaslsise


                         +         -         -         -         -         *         -:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
00369591   1/1  LskiaptvvllyvlgantledwleqirllgkalgkeeeAeklladyeqrlaalkakladllkgkkvlvll
00521721   1/1  pnlEaiaalkPDlIla.sgrqaelydqlskiaptvvvllldadsledilesirllGkllgkeeeAeelia
00482711   1/1  qlekigipvvvldpssledilesirllgkllgkeeeAeeliaelearlaalkakladlp..kprvlvlls
00525191   1/1  dlieqlekigipvvvldvngeggesledlleqirllgkllgkeeeaeeliakleaklaalrerlkgikkp


                         -         -         -         +         -         -         -:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
00369591   1/1  vggggllvyganslagdllellGlknaasdlegalgyatvslEalleldpdvilvldrgdeelleallan
00521721   1/1  elearlaelkakladi.pvvlvylvsggglyvygggsfigellellGgknvaadlsggsgyppvslEall
00482711   1/1  ldg.lytagkgsligellelaGgknvaadlg..ggyptvslEqllaanPdvilvsdlg....llsnplwk
00525191   1/1  tvlyllvsgdglyvagdgsfigsllellGlknvaadl..gggyvtislEqllkldPDvilisdsgtaest


                         -         *         -         -         -         -         +:350
query           SNQAIPVDGDSWYLNASLVSAEIILQGLKDNVTV------------------------------------
00369591   1/1  plwqslpAvkngrvyvldadlwl..ggplsal--------------------------------------
00521721   1/1  elnpdvilvsdrgaalgd----------------------------------------------------
00482711   1/1  slpAvkngrvyvldgdlllr.pgprll.lale--------------------------------------
00525191   1/1  leallnnpvwsdlkAvkngrvylldaelytlr--------------------------------------