[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cglu2:BAF55235.1


[Show Plain Result]

## Summary of Sequence Search
   1::196
 126::195  4.8e-08 28.6% 0051684 00516841 1/1   domain 2-like                           
 136::190  2.6e-06 27.3% 0036157 00361571 1/1   domain 2-like                           
 112::179  0.00026 26.5% 0036422 00364221 1/1   domain 2-like                           
 136::190  0.00055 29.1% 0035731 00357311 1/1   domain 2-like                           
 111::166   0.0027 30.4% 0047794 00477941 1/2   domain 2-like                           
 172::196       21 40.0% 0047794 00477942 2/2   domain 2-like                           
   1::196


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVNYPTPRFQISIKHGLIVCIILVVAFVGWFFTREKPVNPPTMAALAETYQTPAPSSQVVVSVVGHVAK
00516841   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00477941   1/2  ----------------------------------------------------------------------
00477942   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEVQPISVDAAATSASGLISLNT
00516841   1/1  -------------------------------------------------------hrlaiighrklrlle
00361571   1/1  -----------------------------------------------------------------tleer
00364221   1/1  -----------------------------------------lfalgIpgvGektakkLlkhfgslealle
00357311   1/1  -----------------------------------------------------------------tleer
00477941   1/2  ----------------------------------------lllllgipgvGpkraklLlkhfgslealle
00477942   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP--------------
00516841   1/1  rllsaLtgipgvgpvlakaLlehfgsleallaasleeLaevpgiGpkkaesikdf---------------
00361571   1/1  elfelLlsvsgiGpklAlailsvlgleelleaiaegdleaLlkvpgiGkk--------------------
00364221   1/1  asveeLlevegigekvAesiveffaepknreliekllaa-------------------------------
00357311   1/1  elfllLlsvsgvGpklAlailsvldleelleaiangdlkaLlkvpgiGkk--------------------
00477941   1/2  AsveeLaevpgigeklAesileflse--------------------------------------------
00477942   2/2  -------------------------------sveeLaevpgigeklAesileflse--------------